KEGG   Xenopus tropicalis (western clawed frog): 549012Help
Entry
549012            CDS       T01011                                 

Gene name
tmed10
Definition
(RefSeq) transmembrane emp24-like trafficking protein 10 (yeast)
  KO
K20352  p24 family protein delta-1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    549012 (tmed10)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    549012 (tmed10)
Membrane trafficking [BR:xtr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    549012 (tmed10)
Transporters [BR:xtr02000]
 Other Transporters
  Others
   549012 (tmed10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L Cofac_haem_bdg RE_SinI
Motif
Other DBs
NCBI-GeneID: 549012
NCBI-ProteinID: NP_001016258
Xenbase: XB-GENE-968508
UniProt: Q28FV9
LinkDB All DBs
Position
8
AA seq 207 aa AA seqDB search
MARLLPVLFALLFCGYVQPISFSLPPNSRKCLREEIHKNVLVTGEYELSEAHNQGQVRLK
ITDSAGHILYSKEDASKGKFAFTTEEYDMFEVCFDSKLPAGAGRVPDQMVNLIMKHGVEA
KNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNVRVLYFSIF
SMCCLMGLATWQVFYLRRFFKAKKLIE
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggcccggttgctcccagtccttttcgcgctgctcttttgcggctacgtgcagcctatt
tctttttcgctgccgcctaacagccgcaagtgtttgcgagaagagattcacaagaacgtg
ctcgtaaccggagagtacgagctgtctgaggcccacaaccagggccaagtgcgactaaag
attacagactctgctgggcacattctctactccaaggaagatgcttccaaggggaaattt
gctttcaccactgaggaatatgatatgtttgaggtctgcttcgatagtaagctaccagca
ggtgctggcagagtgcctgatcagatggtcaatctcataatgaagcacggagtagaagca
aaaaattatgaagagattgcaaaggtagagaaacttaaaccacttgaagttgaacttcgg
cgtcttgaggatttgtcagagtctatcgtcaatgattttgcctatatgaaaaagagagag
gaagaaatgagggacacaaatgaatccaccaatgtacgtgtcctttacttcagcatattc
tccatgtgttgcctaatgggactggccacctggcaagttttctatctccgtcgcttcttt
aaggccaaaaaactaattgaatga

DBGET integrated database retrieval system