KEGG   Xenopus tropicalis (western clawed frog): 549105Help
Entry
549105            CDS       T01011                                 

Gene name
lig3
Definition
(RefSeq) ligase III, DNA, ATP-dependent
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03410  Base excision repair
Module
xtr_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    549105 (lig3)
Enzymes [BR:xtr01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     549105 (lig3)
DNA repair and recombination proteins [BR:xtr03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     549105 (lig3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 549105
NCBI-ProteinID: NP_001016351
Xenbase: XB-GENE-5788004
UniProt: B4F6N5
LinkDB All DBs
Position
10
AA seq 893 aa AA seqDB search
MRAFLRLLAYQTKRTLGQSLTKVPLRVIFHACWSQSPLHSALHFQFFLRVTHFSNMAEQR
YCVEYAKRGTAGCKKCKEKIGKGLVRIGKIVPNPFSESAGDMKEWYHIKCMFEKLERARA
TTKKIDDLTELEGWQELQDCDKNLISQHVTELATKTAATPRKKTPSKEKQSPAVQGTTST
TAPAASPSLKFSGFSAKPSQSSSPPSSSTGSSLSTAKCDPKHKDCLLREFRKLCAMVAEQ
PSYNSKTQIIRDFLTKGTSGDGFHGDTYLTVKLLLPGVIKSVYNLNDKQIVKHFSRIFNC
NQEEMVRDLEQGDVSETVRIFFEESKCFAPASKSLLTIHEVDDLLTKLSKMTKEEDQQNV
LEDIAHRCTSNDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYDAFKASRNLGDVVERVLR
NEQQAPGMKRTLSVQASLMTPVQPMLAEACKSIEYAMKKCPNGMYAEIKYDGERVQVHKN
GDHFSYFSRSLKPVLPHKVAHFKDFIPKAFPGGNSMILDAEVLLIDTNTGKPLPFGTLGV
HKKAAFKDANVCLFVFDCIYFNGVSLMDRPLSERRKFMRDNMVEIPNHILFSEMKHVTKA
SDLADMITRVIREGLEGLVLKDLKSNYEPGKRHWLKVKKDYLNEGAMADTADLAVLGAYY
GKGANGGIMSIFLMGCYDPESQKWCTVTKCSSGYDDATLQRLQKELNMVKISKDPSKIPS
WLKINKNYFPDFIIHDPKKAPIWEITGAEYSKAEAHTAAGLSIRFPRCTRFRDDKDWKTA
TTLQQLKELYRLSKEKSDFNITATSSQDEDGSSESSSRENEGNSRQTASGSMVKKSKNAP
SKSPGKDKTSESTKLPPPQKKEELPKAEKRKSQTPKTVQSKKVRKQHIEKCIQ
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atgagggcatttcttagacttctggcatatcagaccaaaaggacacttggccagtcctta
acaaaagttcctttacgagttatttttcatgcctgttggagccagtcgcctctccacagt
gctttgcacttccaattctttttaagagttacacatttctccaacatggcggaacagcga
tactgtgtggaatatgcaaaacgtgggactgctggttgcaagaaatgcaaggagaagatt
ggaaagggtttggtacgcataggtaaaatagtgccaaacccttttagcgagtctgctggg
gacatgaaggagtggtaccacatcaagtgcatgtttgagaaactggagagagcgcgggca
actacaaaaaaaattgatgatctgacagaactggaaggttggcaggaacttcaagactgt
gataaaaacctaatcagccagcatgtcactgaacttgctacaaaaacagcagctacacct
cgaaaaaagactccgtccaaggaaaaacaatcaccggcagtacaaggaacaacttccact
acagcaccagcagctagtccctctctaaaattttcaggtttctctgcaaaacccagtcaa
tcatcaagcccaccaagctcaagcactggctccagtctttcaactgcaaagtgtgaccca
aaacataaggactgtcttctgcgtgagttccgcaagctatgtgcaatggttgcggaacag
ccaagctacaacagcaaaacacagatcattcgtgatttcctaaccaagggaacaagtggc
gatggttttcatggtgacacatatctgacagtaaaactgctattaccaggagttatcaag
tctgtgtacaacctcaatgataagcagattgttaaacactttagtcgtatttttaattgt
aaccaggaggagatggttcgggacctagaacagggagatgtgtctgaaactgtgcgtatc
ttctttgaggaaagtaaatgctttgcaccagcttctaagagtttactgacaatccatgaa
gttgatgatttgcttactaaactatcaaaaatgactaaagaagaagatcaacagaatgtc
ctagaggacattgctcacaggtgcaccagtaatgatcttaaatgcattatccgcctgatt
aaacatgacttgaaaatgaactctggagccaaacacgtgctggatgctctagatcctaat
gcatatgatgcatttaaagcttcgcgcaatctaggggatgtagtagaacgtgttttgcgc
aacgagcagcaggctccaggaatgaaacgaactcttagtgtccaggcttcattaatgacc
ccagttcagcctatgctggctgaagcttgcaaatctatagagtatgccatgaaaaagtgt
cccaatggtatgtatgctgaaataaagtatgatggtgaaagagtccaagtacataagaat
ggagatcacttcagctacttcagccgcagtctgaagccagtgctgccccataaggttgct
cattttaaggattttatacctaaagcatttccaggaggaaacagtatgatcctggatgca
gaagttcttcttatagataccaatactggcaagccacttccatttggcacattaggtgtt
cataagaaagctgctttcaaagatgccaatgtgtgcttgtttgttttcgattgcatttac
ttcaatggagtgagcttaatggatcggccacttagtgagcgccgaaagtttatgcgggat
aacatggttgaaatccctaatcacattctgttctctgagatgaaacatgtcacaaaagct
tctgatctggctgacatgatcacccgtgttatccgtgagggattggagggtctggtatta
aaggacttaaagagtaattatgagccagggaaacgtcattggcttaaagtaaagaaggat
tacttgaatgaaggtgcaatggcagacaccgctgacttggcagttttgggagcttattat
ggaaagggagcaaatgggggtataatgtccatctttctcatgggttgctatgatcctgaa
agtcagaagtggtgcactgtgacaaaatgttcaagtggttatgatgatgctactctgcaa
cgccttcagaaggagcttaacatggtcaaaatcagcaaggatccatctaagattccatca
tggcttaaaatcaacaagaactatttcccagatttcattatacatgatcccaagaaagct
cccatttgggaaattacaggtgcagagtactcaaaggcagaggctcatacagctgctggg
ttatccattcgcttcccacgctgcacacgtttccgtgatgataaggactggaaaacagcc
actacactccaacagctaaaggaactttatcgtctctcaaaagaaaaatctgactttaac
atcactgctacatcctctcaggatgaggatggttcatctgaaagcagtagtcgagagaat
gaaggaaactccaggcaaactgcatcaggcagcatggttaagaaatcgaaaaatgctcct
tccaaatctcctggaaaggacaaaaccagtgaaagcactaaactacctcctcctcagaag
aaagaagagctgccgaaagcagagaagcgcaaatcacaaactcctaaaactgtacagagt
aaaaaggttaggaaacaacatatagagaaatgtatccagtag

DBGET integrated database retrieval system