KEGG   Xenopus tropicalis (western clawed frog): 549125Help
Entry
549125            CDS       T01011                                 

Gene name
mecr, cgi-63, fasn2b, nrbf1
Definition
(RefSeq) mitochondrial trans-2-enoyl-CoA reductase
  KO
K07512  mitochondrial enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase [EC:1.3.1.- 1.3.1.38]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00061  Fatty acid biosynthesis
xtr00062  Fatty acid elongation
xtr01100  Metabolic pathways
xtr01212  Fatty acid metabolism
Module
xtr_M00085  Fatty acid elongation in mitochondria
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    549125 (mecr)
   00062 Fatty acid elongation
    549125 (mecr)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.38  trans-2-enoyl-CoA reductase (NADPH)
     549125 (mecr)
    1.3.1.-  
     549125 (mecr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 PALP
Motif
Other DBs
NCBI-GeneID: 549125
NCBI-ProteinID: NP_001016371
Xenbase: XB-GENE-1007523
UniProt: Q28GQ2
LinkDB All DBs
Position
2
AA seq 350 aa AA seqDB search
MWLGLRLFHRPFSSLAARGLVYEKHGEPLQVLRLKNVNITHPADNEVRVKMLAAPINPSD
INMVQGTYALLPQLPAVGGNEGVGVVVEIGRHVSSMRPGDWVVPVDAGLGTWCTEAVFSE
DSLVRVPSDIPVAGAATVSVNPCTAYRLLSDFETLRPGDTIIQNASNSGVGQAVIQIATS
LGITTINVVRDREDLSSLIQRLRDLGADHVITEEQLRKPEMKDLFKNCPRPRLALNCVGG
KSTTEMLRHLDYGGTMVTYGGMSKQPVTVPVSALIFKNVKLCGFWVTQWKKERAQTDREE
IVKMIRDLCDLIRRGKLVPPPSTQRPLEDFSRALQDSQTPFLSRKQILIM
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtggctagggttgcggctatttcaccgtccattcagctccctggcggcccgcgggcta
gtttacgaaaagcacggagagccgttacaagtattacgcttgaaaaatgtgaacattaca
caccctgcagataatgaggttcgagtgaaaatgttggctgcccctattaatccatcagat
attaacatggtccaaggaacctatgctcttctgcctcagctgccagctgttggagggaat
gagggagtaggtgtggtagtagaaataggaagacatgtgtcctccatgaggcccggtgat
tgggtagttcctgtggatgcagggttaggcacgtggtgtacagaggccgtgttcagcgag
gattcccttgtgcgagttccaagtgacattcctgtggcaggagctgcaactgtgagcgtc
aatccctgcactgcttacagacttctctctgattttgagactcttcggccaggtgacact
ataatacaaaatgcaagcaacagtggcgtgggccaggctgttatacagattgcaacatca
ctgggcatcaccaccattaatgttgtgcgggacagggaagacctgtcgagcttaatacag
agactccgtgacctgggagcagatcatgtgatcacagaagaacagctccgcaaacctgag
atgaaggatttgttcaagaattgtcctcgaccaagactggctttaaattgtgttggtgga
aaaagcacaacagaaatgttgcgtcatttggattatggtggcacaatggtgacatatgga
gggatgtcaaagcagcctgttactgtccctgttagcgcacttatatttaaaaatgtaaaa
ctgtgtggtttctgggtaactcagtggaagaaagaacgagctcagactgatcgtgaggaa
attgtaaagatgatacgggatctttgtgatctgatccgccgtggaaagcttgttcctcct
ccatctactcaacggcctctagaagatttctccagagccctccaagattctcagactcct
ttcttgtcccgcaagcaaatactaataatgtga

DBGET integrated database retrieval system