KEGG   Xenopus tropicalis (western clawed frog): 549131Help
Entry
549131            CDS       T01011                                 

Gene name
aldh7a1, atq1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00053  Ascorbate and aldarate metabolism
xtr00071  Fatty acid degradation
xtr00260  Glycine, serine and threonine metabolism
xtr00280  Valine, leucine and isoleucine degradation
xtr00310  Lysine degradation
xtr00330  Arginine and proline metabolism
xtr00340  Histidine metabolism
xtr00380  Tryptophan metabolism
xtr00410  beta-Alanine metabolism
xtr00561  Glycerolipid metabolism
xtr00620  Pyruvate metabolism
xtr01100  Metabolic pathways
Module
xtr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
xtr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    549131 (aldh7a1)
   00053 Ascorbate and aldarate metabolism
    549131 (aldh7a1)
   00620 Pyruvate metabolism
    549131 (aldh7a1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    549131 (aldh7a1)
   00561 Glycerolipid metabolism
    549131 (aldh7a1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    549131 (aldh7a1)
   00280 Valine, leucine and isoleucine degradation
    549131 (aldh7a1)
   00310 Lysine degradation
    549131 (aldh7a1)
   00330 Arginine and proline metabolism
    549131 (aldh7a1)
   00340 Histidine metabolism
    549131 (aldh7a1)
   00380 Tryptophan metabolism
    549131 (aldh7a1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    549131 (aldh7a1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     549131 (aldh7a1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     549131 (aldh7a1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     549131 (aldh7a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 549131
NCBI-ProteinID: NP_001016377
Xenbase: XB-GENE-492001
UniProt: Q28GS6
LinkDB All DBs
Position
1
AA seq 511 aa AA seqDB search
MSSLLINQPEYSWLKELGLKEDNEGVYNGTWGGKGEVVTSYCPGNNAPIARVKQATLDEY
NETVNKAKEAWKIWADIPAPKRGEIVRQIGDALRKKIKLLGHLESLEMGKILVEGVGEVQ
EYVDICDYAVGLSRIIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNALA
LICGNVCLWKGAPTTSLTSVAVTKIVAQVFEDNKLPGAICSLTCGGADIGNAIAKDERVD
LVSFTGSTNVGKQVALKVQERFGRKLLELGGNNAIIVFEDADLSLVTPSVLFAAVGTAGQ
RCTTARRLFLHESIHDEIVEKLSKAYAQVRIGDPCAPDTLCGPLHTKQAVEMYLSAVEQA
KCEGGTVVCGGKVIDRPGNFVEPTIMTGLAHDAAIVHKETFAPILYVIKFKTEEEAFAWN
NEVKQGLSSSIFTKDLGRIFRWLGPKGSDCGLVNVNIPTSGAEIGGAFGGEKHTGGGRES
GSDSWKHYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctctgttaattaaccaacctgagtattcatggctgaaagaactgggcttgaag
gaggacaatgaaggagtttacaatggtacatggggaggaaaaggagaggttgtgacatct
tactgccctgggaacaatgcaccaatagctagagttaaacaggccacactggatgaatac
aatgaaactgttaataaagctaaagaagcatggaagatctgggcagatatcccagcacca
aagcgtggggaaattgtgagacaaattggggatgcgctgaggaaaaagataaaactactt
ggacacttggaatccttagagatgggaaagatattagttgaaggagttggagaagtccag
gaatacgtagatatctgtgattatgctgtagggctttctcgtataattggaggacccata
ctgccttcagaaagacctgggcatgctcttattgaacagtggaatccagtgggtttggtg
ggtataattaccgccttcaattttcctgttgctgtatacggctggaacaacgcacttgca
cttatctgtggaaatgtctgtttatggaaaggagctccaaccacatcccttactagtgtt
gctgtgacaaaaatcgttgcacaagtatttgaagataacaaattgcccggtgctatctgt
tccttgacttgtggtggtgcagacattggcaatgccatagcaaaggatgaaagagtagat
ctggtgtcatttactggcagcacaaatgttggcaagcaggtggcacttaaagttcaagaa
aggtttggacgcaagttactggaactgggtggaaacaatgccattatagtgttcgaggat
gctgatcttagcctagtaactccttctgttctgtttgctgctgtgggcacagcaggccag
agatgcactactgccagaaggctgtttttacatgaaagcattcatgatgaaattgtggaa
aagctctctaaagcttatgcacaggtgcgaattggagatccttgtgcgcctgacacactt
tgcggtcctctacacactaagcaggcagtggaaatgtatctctctgctgttgaacaagca
aaatgtgaagggggtacagttgtgtgtggtggcaaggtaatagatcgcccagggaatttt
gttgagccaactattatgactggactggctcatgacgccgctattgttcacaaagagact
tttgctccaatactgtacgtgattaaatttaagactgaagaagaagcttttgcatggaat
aatgaggtgaaacagggcctttcaagcagcatctttactaaggatcttggaaggattttc
cgctggcttgggccaaagggttcagactgtggcttggtgaatgtgaacattcctaccagt
ggagctgaaattggaggagcttttggaggtgaaaaacacacaggaggtgggagagaatct
ggcagtgactcctggaaacattatatgagaaggtctacctgtaccatcaattacagcaag
gacttgccactggcacagggtataaaattccagtga

DBGET integrated database retrieval system