KEGG   Xenopus tropicalis (western clawed frog): 549262Help
Entry
549262            CDS       T01011                                 

Gene name
suv39h2, kmt1b
Definition
(RefSeq) suppressor of variegation 3-9 homolog 2
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    549262 (suv39h2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    549262 (suv39h2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     549262 (suv39h2)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     549262 (suv39h2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    549262 (suv39h2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 549262
NCBI-ProteinID: NP_001016508
Xenbase: XB-GENE-852675
UniProt: Q28CQ7
LinkDB All DBs
Position
3
AA seq 406 aa AA seqDB search
MAAARGAWCVPCLASIETLQELCRKEMLICTNIGITRKNLNNYEVEYLCDYRIEKGVEKF
FVKWKGWPESCNTWEPTRNLKCPTLLKQFYSDLYNYFCALKPNKKGFLKNSIKSLDPSLS
DYIVKKAKQRIALRRWEEELNRKKTHSGTLFVENTVDLEGPPMDFYYINDYKASPGVNTL
GEAIVGCDCSDCFKGKCCPTEAGVLFAYNEHRQIKIPPGRPIYECNSRCKCGPDCPNRVV
QKGPPYSLCIFRTDNGRGWGVKTLQKIKKNSFVMEYVGEVITSEEAERRGQQYDSRGITY
LFDLDYEADEFTVDAARYGNVSHFVNHSCDPNLQVFNVFIDNLDVRLPRIALFSTRNIKA
GEELTFDYQMKGSGDFSTDSIDMSPAKKRVRIACKCGAATCRGYLN
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctgcagcgcgtggagcttggtgtgtgccatgccttgcttccatcgaaacattgcag
gagttgtgcaggaaagaaatgctcatttgtacaaacattggaattaccaggaaaaattta
aataattatgaagtagaatatctatgtgactacaggattgaaaagggtgtagaaaaattc
tttgtgaagtggaagggatggccagagtcttgtaatacttgggagcctacaagaaacttg
aaatgcccaacgcttttaaaacagttttacagtgacctttacaattatttctgtgcactt
aaaccaaataaaaaagggttccttaaaaacagcattaagtctttggacccttctctttct
gactatatagtcaaaaaggctaaacagaggattgctttacggcgctgggaagaagagctg
aacaggaaaaaaacccatagtggtactctttttgttgaaaatactgtcgatttagagggt
cctcctatggacttttactatatcaatgattacaaggcctctcctggagttaacacattg
ggtgaagccattgttggctgtgactgctcggattgctttaaaggcaaatgttgtcccaca
gaagcaggagtcctctttgcatataatgaacacaggcaaataaaaatcccaccaggaaga
ccaatttatgaatgcaattcaagatgcaaatgtggtccggattgtcctaacagggtggtg
caaaaggggccaccctattccttatgcatctttaggacagacaatggtcgtggctgggga
gtaaagacactccaaaaaataaagaaaaatagttttgtgatggagtatgttggcgaggta
ataacaagtgaggaggcagagcgaaggggtcaacagtatgacagcagagggatcacatat
ctgtttgatctagactatgaggcagatgagtttacagttgatgcagctcgatatgggaac
gtctcgcattttgtgaatcacagttgtgatccaaaccttcaggtatttaatgtcttcatt
gataatcttgatgtacgtcttccacgtattgcgttgttttcaaccagaaacatcaaggcc
ggagaagaacttacatttgattaccaaatgaaaggttctggggactttagcacagattct
attgatatgagccctgccaagaaaagagtgaggatagcttgcaaatgtggagctgccacc
tgccgtggataccttaattaa

DBGET integrated database retrieval system