KEGG   Xenopus tropicalis (western clawed frog): 549513Help
Entry
549513            CDS       T01011                                 

Gene name
cdc23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04110  Cell cycle
xtr04114  Oocyte meiosis
xtr04120  Ubiquitin mediated proteolysis
xtr04914  Progesterone-mediated oocyte maturation
Module
xtr_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    549513 (cdc23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    549513 (cdc23)
   04114 Oocyte meiosis
    549513 (cdc23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    549513 (cdc23)
Ubiquitin system [BR:xtr04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     549513 (cdc23)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    549513 (cdc23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 ANAPC3 TPR_16 TPR_17 TPR_12 TPR_9
Motif
Other DBs
NCBI-GeneID: 549513
NCBI-ProteinID: NP_001016759
Xenbase: XB-GENE-1015904
UniProt: Q28D09
LinkDB All DBs
Position
3
AA seq 581 aa AA seqDB search
MAATSGMFSDLKEIKKQLLSVTWLCRERGLMHSVKWASELAFSLESIPLNELPSTPALTE
EDAQDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEKKKDDETVDSL
GPLEKGQVKNEALRELRVELSKKHKARELDGFGLYLYGVVLRKLDLAKEALDVFVEATHV
LPLHWGTWLELCNLITDKEMLKFLSLPESWIKEFFLAHIYTELQLIEEALQKYQSLIDAG
FSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLYVRGLKPELSY
LAHNLCDIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAWTLMGHEYMEM
KNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQLRPNDSRMLVA
LGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQCYIKYIQDIY
SCGEIVEHQELSTAFRYLAQYYFKCKLWDEASACAQKCFNFNDTREEGKALLRQILQLRN
QNESPSADLPATAPFFLPQSLSANNTPTRRVSPLNLSSVTP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacaagcgggatgttttctgatttgaaggaaatcaagaaacagctgctaagc
gtaacctggctttgccgggagagaggtctgatgcatagcgtcaaatgggcatcagaactt
gctttctctctggaatctattcctttaaatgagcttccttcaaccccagcacttacagag
gaggatgcccaggatctggatgcatatacactggctaagtcttactttgacctaaaagaa
tatgatcgagctgcatattttcttcgggggtgtaagagccagaaagcctatttcttgtac
atgtactccaggtacttgtctggagaaaagaagaaggatgatgaaacagttgatagcctt
ggtccccttgaaaaagggcaggtaaagaatgaggctctgagggaactacgtgtggagctg
agtaagaagcacaaagccagggaattagatggatttggactgtacttgtatggagtggtc
ttgaggaagctggatctggcaaaagaagcgttagatgtatttgtggaggcaacacatgtt
ttgcccttacattggggaacctggctggagttatgtaatttgattacagacaaagagatg
ctgaagttcctgtccctgccagaatcatggataaaggaatttttcttggcacacatatat
acagagctgcagttgattgaggaagcattgcagaaataccaaagtcttattgatgctggc
ttttccaagagtacttacattatttctcaaattgctgttgcctaccataacatccgagat
attgacaaagctctgtctatattcaatgagctgcggaaacaggatccttacagaatagaa
aacatggacaccttttccaacctcctgtatgtcaggggtctgaaaccagaattaagctat
ttggcccacaatctatgtgacattgacaagtaccgtgttgagacctgttgcgttatcggc
aattattacagcttgcgctcccagcatgaaaaagcagcgctgtacttccaaagggcacta
aaactcaaccctcgatatcttggtgcttggaccctcatgggccatgaatacatggaaatg
aagaacacttctgcagcaatacaggcttacaggcatgcaattgaagtgaacaagagagat
tatcgtgcttggtatggattaggacaaacctatgaaatattaaagatgccattttactgc
ctttattattatagacgggcccatcagctcagacccaatgactctagaatgcttgttgct
ttgggggaatgttatgaaaagcttaatcaacttgtggaggctaaaaaatgttactggaga
gcttatgctgtaggtgatgttgagaaaatggctctggtcaagctggcaaagcttcatgaa
caactgaatgaatcagaacaggctgcccagtgttacatcaaatacatacaggacatctac
tcctgtggggaaattgtagagcaccaggagctcagcacagcctttcgctatctggctcag
tattactttaagtgcaagctgtgggatgaagcatctgcatgtgcccagaaatgcttcaat
tttaatgataccagggaagaagggaaagctcttctacggcaaattctacaattaaggaac
cagaatgaaagtccatcagctgacctcccagccactgctccattctttcttccgcaatct
ctttcagccaacaacacccctacaagacgagtgtctccacttaacctgtcatctgttaca
ccttag

DBGET integrated database retrieval system