KEGG   Xenopus tropicalis (western clawed frog): 549599Help
Entry
549599            CDS       T01011                                 

Gene name
aqp3, AQP-x3, Aquaporin-3, aqp-3, aqp-3b, aqp3-a, aqp3-b, aqp3b, gil
Definition
(RefSeq) aquaporin 3 (Gill blood group)
  KO
K09876  aquaporin-3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    549599 (aqp3)
Transporters [BR:xtr02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    549599 (aqp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 549599
NCBI-ProteinID: NP_001016845
Xenbase: XB-GENE-488014
UniProt: Q28DL6
LinkDB All DBs
Position
1
AA seq 294 aa AA seqDB search
MGRQKDFINKCNQLLRLRNKLLRQALSECLGTLILVMFGCGSVAQVVLSKGSHGQFLTVN
LAFGFAVMLGILISGQVSGGHLNPAVTFALCIMAREPWIKFPIYSFAQTLGAFLGAGIIY
GLYYDAIWFFGNDQLFVMGENGTAGIFTTFPSEHLTLINGFFDQFIGTAALIVCVLAIVD
PNNNPIPRGLEAFTVGFVVLVIGTSMGFNSGYAVNPARDFGPRLFTSLAGWGTEVFWAGN
QWWWVPIVSPLLGAFTGVLVYQLMIGCHIEPAQTPQSTEQENIKLADVKNKDRI
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgggacgccagaaggattttatcaacaaatgcaaccagttgctgagactgaggaacaag
ctgctgagacaggcgctgtcggagtgtctggggactctcattctggtgatgtttggctgt
ggctctgtggctcaggtggttctcagtaagggatcccacggacaattcctgactgtcaat
ctggccttcggatttgccgtcatgcttgggattttaatatccggacaggtatcaggtggc
cacttgaacccggcagtgaccttcgccctgtgcatcatggccagagagccctggatcaag
ttccccatctacagctttgcccagacgttgggagccttcctcggtgccggcatcatctac
ggcctgtattacgatgccatttggttctttggaaacgaccaactctttgtaatgggcgaa
aatggcacggccggcatcttcaccacattcccatcggagcatctgacacttataaatggg
ttttttgatcagttcattggaaccgcagctctgattgtctgtgttctggccattgttgat
ccaaacaataacccgatccctcgtgggctggaagccttcaccgtggggtttgttgtcctc
gtcattgggacttccatgggcttcaactctggttacgccgtcaaccccgccagggacttt
gggcctcgactcttcacatctctggccggatggggcaccgaagtcttctgggccgggaac
cagtggtggtgggtgcctatcgtctcgcccttactgggagcctttactggagttttagtc
tatcagctgatgatcggatgccacattgagcctgcacaaactcctcaatccaccgaacaa
gaaaatatcaaactggcagatgtcaaaaacaaggacagaatctga

DBGET integrated database retrieval system