KEGG   Xenopus tropicalis (western clawed frog): 549721
Entry
549721            CDS       T01011                                 

Gene name
nr3c1
Definition
(RefSeq) glucocorticoid receptor
  KO
K05771  glucocorticoid receptor
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    549721 (nr3c1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    549721 (nr3c1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:xtr03310]
    549721 (nr3c1)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    549721 (nr3c1)
Nuclear receptors [BR:xtr03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   549721 (nr3c1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 549721
NCBI-ProteinID: NP_001016967
Xenbase: XB-GENE-484757
UniProt: Q28E31
LinkDB
Position
3
AA seq 778 aa
MDPKDLLKPSSGSPAVKGSPHYNDKPGNVLEFFGNYRGGVSVSVSASCPTSTASQSNTRQ
QQQFLKQKAVTGDSTNGLNNVPQPDLSKAVSLSMGLYMGEPDTKGMGNDIAFPPQEQTGI
STGETDFSLLEESIASLQATTLPPDRLLEMPEDPGVLKCDVSAQPRPSMLGQGGSNGNST
IKLSLTDQSTFDLLQDLDIPPDSPTGGKRNPWLDPLFDEEEAFSLLTPLATDDTFLMKSE
VLSESSKPLGLEDSTHKLSDRAKEGLLSTAALPVTQVKTEKEDYIELCTPGVVKQEKFGP
VYCLGGLSGSGLFGNKSSAISVHGVSTSGGQMYHYDLNTSTISQHQQDLKPIFNLGSPGT
SIAEGWNRCHGSVDDSSASPGNVNFPNRSVFSNGYSSPGIRPDVSPSPSTSSTSTGPPPK
LCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACRYR
KCLQAGMNLEARKTKKKIKGIQQSNTVATREPPESSVTRTMVPAAVAQLTPTLISLLEVI
EPEVLYSGYDSSIPDTTRRLMSSLNMLGGRQVVSAVRWAKAIPGFRNLHLDDQMTLLQYS
WMFLMVFALGWRSYKQANGSVLYFAPDLVITDDRMHLPFMQERCQEMLKIAGEMSRLQIS
YDEYLCMKVLLLMCTIPKEGLKSHALFEEIRMTYIKELGKAIVKREGNSSQNWQRFYQLT
KLLDSMHEVAENLLAFCFLSFLDKSMSIEFPDMLSEIISNQIPKYSSGNIKKLLFHQK
NT seq 2337 nt   +upstreamnt  +downstreamnt
atggaccccaaagaccttttaaagccctctagtggatcaccggcagtgaagggctcacct
cattacaatgacaagccagggaatgtgcttgaattctttggaaattataggggtggagtt
agtgtaagtgtatctgcatcttgcccaacctcaactgcttcacagtcaaacactaggcag
caacagcagtttctcaaacagaaagccgtgactggggattcaactaatggattgaataac
gtgcctcagccagatttgtctaaagcagtttcactctcaatgggactctacatgggagag
ccagacacaaaagggatgggcaatgatattgcctttccaccccaagagcaaactggtatc
tccacaggagaaactgattttagtctcttggaagagagcattgccagcttgcaggctacg
acattgcccccagatagactcctagagatgccagaggatcctggggttttaaaatgtgac
gtatctgcccaaccaaggccttccatgctaggtcaggggggcagcaatgggaacagcact
atcaagctgtctcttacagaccaaagcacctttgacctattacaggacctggatatcccg
ccagactcacctacgggtggtaaaagaaatccttggctagacccccttttcgatgaggaa
gaagcttttagtctgttgaccccactggccactgatgatacttttctcatgaaatctgaa
gtactgagtgagagtagcaaacctctcggcctcgaagatagcacacacaaactcagcgat
cgtgccaaggaaggactgttgtctactgcagccctaccagtaactcaagtcaagactgaa
aaagaggactacattgagctttgcacacctggggtggtgaagcaggaaaagtttggtcct
gtttattgtctaggcgggctttcaggatctggcttatttggtaacaaatcttcagctatt
tctgtccacggcgtcagcacttcaggtgggcagatgtaccactatgacttaaacacttcc
accatctcacagcatcagcaggatcttaagcctatctttaatcttggctcacctgggact
agcattgcagaaggctggaataggtgccatggatctgtggatgacagttccgcttctccg
gggaatgtaaattttccaaacagatctgttttttcaaatggctattcgagccctggaata
agacctgatgtgagtccttctccatccacctcttctaccagcacggggccaccacctaag
ctctgtttggtgtgctctgacgaggcttctgggtgccactacggagtattgacttgcggc
agctgtaaagttttctttaagagagcagttgaaggtcagcataattacctttgcgctgga
cggaatgattgcattattgataaaataagaaggaagaactgcccggcatgtcgctaccgg
aaatgtcttcaagctggaatgaatcttgaagctcggaagacaaagaagaaaatcaaagga
attcagcaatctaatacagttgcaacacgggagcctcctgaaagttctgtgaccagaacc
atggtacctgcagctgtagcacaactcacacctaccctgatctcattactggaggttatt
gagccagaagtgctatattctggatatgacagctccatacctgatacaaccagaaggctt
atgtcttctctcaacatgcttggtgggcggcaggtggtgtctgctgtcagatgggcaaag
gcaattccaggtttcagaaacttgcacctggatgaccaaatgacccttcttcagtactca
tggatgtttttgatggtgtttgcacttggatggaggtcttacaaacaagccaatggaagt
gttctgtattttgctcctgatctcgtcattactgatgacaggatgcacctaccctttatg
caggagagatgtcaagagatgttgaagattgcaggtgaaatgtctcgtcttcaaatttca
tatgatgaatatctctgcatgaaagtgttgttgctcatgtgcacaattccaaaggaaggc
ctgaagagccacgctctgtttgaggaaatccgtatgacatacattaaagaactgggaaaa
gccatagtaaagagggaaggaaattccagtcaaaactggcagcgtttttatcaactgaca
aagctattggactccatgcatgaggtggctgaaaatctactagccttttgcttcctttcc
ttcctggataaatcaatgagtatcgagtttcccgatatgttgtcagaaatcatcagcaat
cagataccaaaatattcatctggaaatatcaaaaaactgttatttcatcaaaagtga

DBGET integrated database retrieval system