KEGG   Xenopus tropicalis (western clawed frog): 549932
Entry
549932            CDS       T01011                                 

Gene name
mpg
Definition
(RefSeq) DNA-3-methyladenine glycosylase
  KO
K03652  DNA-3-methyladenine glycosylase [EC:3.2.2.21]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    549932 (mpg)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xtr03400]
    549932 (mpg)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.21  DNA-3-methyladenine glycosylase II
     549932 (mpg)
DNA repair and recombination proteins [BR:xtr03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     549932 (mpg)
 Prokaryotic type
     549932 (mpg)
SSDB
Motif
Pfam: Pur_DNA_glyco
Other DBs
NCBI-GeneID: 549932
NCBI-ProteinID: NP_001017178
Xenbase: XB-GENE-6258135
UniProt: Q28HX5
LinkDB
Position
9
AA seq 286 aa
MTTVALQRMPRKRQRVQILNNAPCKMILHESTEKHETSSYSEEQKPKISKYFQNPGIHLL
SEFYNQPCTELAKSFLGQVLVRKLPDGTELRGRIVETESYLGGDDEASHSRGGKRTERNV
AMYMKPGTIYVYQIYGIYFCMNVSSQGDGAAVLLRSLEPLEGLDIMRNFRNGRRNEKAKP
LKETELCNGPSKLCQALDINKSYDRKDLTNDQDTWIEAGSKIFDEDIVSCSRIGIGNAGE
WTKKPLRFYIKGNKYVSVRDKYAEANKTFQNTSPDCHAKNNFNTLK
NT seq 861 nt   +upstreamnt  +downstreamnt
atgacaactgtagcattacagaggatgcctagaaaacgtcagcgagtacaaatattaaat
aatgccccctgtaaaatgatcttgcatgaaagcacagaaaagcatgaaacttcttcatac
agtgaagagcagaagccaaagatcagcaaatatttccaaaatcctgggattcatcttctc
tctgagttttataatcaaccgtgtactgaactggccaaatcctttctgggacaggttttg
gtccgtaaacttccagatggtacagaacttcgaggcagaattgtagagacagagtcttat
ttggggggagatgatgaagcctcacattcaagaggagggaagaggacagaacgcaatgtg
gcaatgtacatgaagcctggaaccatttatgtatatcaaatctatgggatatatttctgt
atgaatgttagcagtcagggagatggagctgccgttcttttacggtcccttgagccatta
gagggccttgatataatgagaaattttaggaatggacgaagaaatgaaaaagcaaaacct
ttgaaagaaacagaactttgtaatggaccctccaagctttgccaagccctggatattaat
aagagttacgacagaaaagaccttactaatgaccaagatacatggatagaggctggcagc
aaaatatttgatgaagacattgtatcttgttcacgaattggaattgggaatgcaggagaa
tggacaaaaaagcctttgcggttttatataaaaggaaacaaatatgtcagtgtaagggac
aaatatgcagaggcaaataagacattccagaacactagcccagactgtcatgcaaaaaat
aatttcaatacattaaaataa

DBGET integrated database retrieval system