KEGG   Xenopus tropicalis (western clawed frog): 594935Help
Entry
594935            CDS       T01011                                 

Gene name
slc18a1
Definition
(RefSeq) solute carrier family 18 (vesicular monoamine transporter), member 1
  KO
K08155  MFS transporter, DHA1 family, solute carrier family 18 (vesicular amine transporter), member 1/2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    594935 (slc18a1)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC18: Vesicular amine transporter
   594935 (slc18a1)
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    594935 (slc18a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 594935
NCBI-ProteinID: NP_001025533
Xenbase: XB-GENE-5738585
UniProt: Q5BL82
LinkDB All DBs
Position
3
AA seq 484 aa AA seqDB search
MARCSPCCQWLKKTWESRAPILLVVAVVMFVDCILFTIIAPIAPALLYDIEYGRGNRTFK
NSSGQYPVSNYDSIFNLSHLEDSRKGPYHDQIINITESPGDKKNCYEGKDFLNEENVRVG
LLLAIKAFLQLLFNPIVGKLVTRIGYDAPMFFGFVIVVVSTLLFAFANSYALLCVARGFQ
GIGSSFTMVPALGTLAQVFPDDVERGKAMGLAMSGVAIGVLAGPPFGSAMYEFVGKSSPF
LVIAALALIDGALQCCVLKPTKFSPLSVPETPYRVLLTDPYIVVAAVGLCICNFSFGIME
PTIPIRMMETMCSPPYQLGLAFLPCMLAYFICLNLFAGFAHKIGRWLCIMIGMMALGISV
LCLPLARNIFGLIAPQAGVGIGFGLFETSMFPMMAHLVDIRHTSNYGAIYAISDIALCIG
YALGPSCGGAIAKAIGFTWLMVILGIINLLYAPLFILLRNPPACTQPRGDARAGRIKTSP
HQSG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatgttccccatgttgtcagtggttgaagaaaacatgggagtcccgggctccg
atcctgttggtggttgcagtggttatgtttgtggattgcattctgttcactattattgct
ccaattgccccagctttactttatgacattgagtatgggagaggaaacagaacatttaag
aactcctccggtcagtatcctgtctccaactatgattccatttttaatctttcacacctt
gaagactcaagaaaaggaccttaccatgaccagatcattaatattactgagagtcctgga
gataaaaagaactgctacgaggggaaggactttttaaacgaagagaatgtgcgagtgggt
cttctccttgcaattaaagcctttcttcagcttctgtttaaccccattgtgggtaaactc
gttaccaggattggatatgatgccccaatgttttttggtttcgtaattgtggtcgtctcc
actcttttgtttgcatttgccaactcatatgcccttctttgtgtggccagggggttccag
ggaattggatcatccttcactatggtgccggctctgggcacactggcacaagtgtttccg
gatgatgtcgaaagaggaaaagccatgggtttagccatgagtggtgttgccattggggtg
ctcgctgggcctccctttggttctgccatgtatgaatttgttggaaaatcttctccgttt
ctggttatagctgcattagctcttattgatggagcactgcagtgttgtgtacttaagcct
acaaagttttccccattgagtgtacctgaaacaccctacagggttctcctcacggatcca
tacattgtggtggctgcagtgggtctctgtatttgtaatttttcctttggcataatggaa
ccaactataccaataagaatgatggaaaccatgtgctcccctccctatcagcttggactg
gcttttcttccctgtatgcttgcatatttcatttgcctcaatcttttcgcggggtttgct
cataaaattgggaggtggctatgcattatgattggaatgatggctctaggaatcagtgtc
ctgtgtttgcctttagcaagaaatatttttggactgattgcacctcaagctggagtggga
attggctttggattatttgagacatcaatgtttccgatgatggcccacctggtcgatata
cggcacacttcaaactatggggccatctatgccatctccgatattgctctgtgtattggt
tatgcgctgggcccgtcatgtggaggcgccattgccaaggccattggatttacctggtta
atggtgatattaggtataataaaccttctttatgcccctctcttcattctgctgcgcaac
ccaccagcctgtactcagccaagaggagacgcaagagcaggaagaatcaaaacctctccc
caccaaagtggctga

DBGET integrated database retrieval system