KEGG   Xenopus tropicalis (western clawed frog): 595089Help
Entry
595089            CDS       T01011                                 

Gene name
ptgs2, cox-2, cox2, gripghs, hcox-2, pgg/hs, pghs-2, phs-2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2 (prostaglandin G/H synthase and cyclooxygenase)
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00590  Arachidonic acid metabolism
xtr01100  Metabolic pathways
xtr04370  VEGF signaling pathway
xtr04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    595089 (ptgs2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    595089 (ptgs2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    595089 (ptgs2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     595089 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF Phage_F EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 595089
NCBI-ProteinID: NP_001025697
Xenbase: XB-GENE-482133
UniProt: Q501R2
LinkDB All DBs
Position
4
AA seq 604 aa AA seqDB search
MIVLPAAVFLSLLVFSQAANPCCSNPCQNRGVCMTVGHDRYECDCTRTGFYGENCTKPEF
LSWLRLKLKPAPNTVHYILTHFKGLWNIVNNISFLRDAIMRYVLTSRSHLIDSPPTYNSH
YGYKSWEAFSNLSYYTRTLPPVERDCPTPMGVKGMKELPSAKLVVEKFLMRRKFIPDPQG
SNVMFAFFAQHFTHQFFRTDMAKGAAFTKALGHGVDLNHIYGESLERQHKLRLMKGGKLK
YQMISGEMYPPTVKTTGVDMVYPPHIPDHLQFAVGQEVFGLVPGLMMYSTIWLREHNRVC
DILSNEHPEWDDERIFQTARLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQKFQY
QNRISAEFNTLYHWHPLLPDTFAISEKEYSYPQFLYNNSVMLNHGLTEMVESFSRQTAGR
VAGGRNFPAAITRVAVASIEHSREMRYQSLNEYRKRFMLKPFESFEELTGEKEMSAELEK
LYGDIDAMEFYPGLLVEQPRPGAIFGETMVEIGAPFSLKGLMGNPICSPEYWKPSTFGGS
VGFDIVNSASLQKLICNNVRDCPYTAFHVLKSKPSEKDFINASSDSTLENVKPSLILKEH
ASEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtactacccgccgctgtgttcctctctctgctggttttctctcaagcagcaaac
ccatgctgttcaaatccctgccaaaaccggggggtatgcatgactgttggccacgaccgc
tatgaatgtgactgcacaagaacaggcttctatggagaaaactgcactaaaccggaattc
ctatcgtggttgaggctgaagctgaagccagcccccaacacagtgcactatatcctgaca
cacttcaaaggactatggaatatagtgaacaatatttccttcctgagggatgccattatg
cgatatgtcctgacatcccgatcgcacctgattgacagcccacccacgtataacagccac
tatggatataaaagctgggaggcattctccaatctgtcctattatactcgtaccttgcct
cctgtggaacgtgactgccctaccccaatgggagttaaaggaatgaaagagcttccaagt
gcaaagttggtagtggagaaattcctgatgcgaagaaaatttattcctgaccctcaaggc
tccaatgttatgtttgctttttttgctcaacacttcacacaccagttcttcagaacagat
atggccaaaggggctgccttcaccaaagcattgggccatggggttgatctcaatcatatc
tatggtgaaagcttagaaaggcaacataaactgcgtttaatgaaaggtggcaaactgaaa
tatcagatgataagtggggaaatgtacccaccaacagtgaaaaccacaggagtggatatg
gtgtacccacctcacattccagatcaccttcagtttgccgttgggcaagaggtttttggc
cttgttccagggctgatgatgtactccaccatctggttaagggagcacaatcgggtttgc
gacatactttccaacgagcatccagaatgggacgatgagcgcattttccaaactgcaaga
cttattttgattggtgaaaccatcaagattgtcatagaggactatgtacagcacctcagt
ggataccacttcaaactcaaatttgacccagagctgttgttcaaccagaaattccagtat
caaaatagaatttctgcagaattcaacaccctgtaccactggcacccccttctacccgac
acatttgccatcagtgaaaaggaatacagttacccacagtttctctacaacaattctgtc
atgttaaaccatggcctcaccgagatggttgaatctttcagcaggcaaacagctggacgg
gttgctggaggtaggaattttcctgctgctataaccagagtagctgtggcatccattgag
cacagtagagagatgagataccagtcactaaatgagtaccggaagcgtttcatgctcaaa
ccctttgagtcattcgaagagctaaccggagagaaggaaatgtcggctgaacttgagaaa
ctatacggtgatattgatgccatggaattctatcctggacttcttgtggaacagccacgc
cctggagctatctttggagagaccatggtagagataggagctccattctctctaaaaggc
ctgatgggcaaccccatttgctctcctgaatattggaaacctagtacctttggtggaagc
gtgggttttgatattgtaaattccgcctctttacaaaagctgatctgcaacaatgttaga
gactgcccttacactgcctttcatgtgctaaaaagcaagccttcagagaaggatttcatt
aatgcgagttccgactcaacactggagaatgtaaagccatctttaatactgaaagagcat
gcgtccgaactttag

DBGET integrated database retrieval system