KEGG   Xenopus tropicalis (western clawed frog): 733525Help
Entry
733525            CDS       T01011                                 

Gene name
snx31
Definition
(RefSeq) sorting nexin 31
  KO
K17937  sorting nexin-31
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    733525 (snx31)
Transporters [BR:xtr02000]
 Other Transporters
  Others
   733525 (snx31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SNX17_FERM_C PX RA Med27
Motif
Other DBs
NCBI-GeneID: 733525
NCBI-ProteinID: NP_001037914
Xenbase: XB-GENE-5933724
UniProt: Q28HD5
LinkDB All DBs
Position
6
AA seq 428 aa AA seqDB search
MHICIPVTEELQDTLGCRFVLYSVYLEGFLLCKVRYKDLHLWNEQIYRVFGNRLPKFPPK
YYLAMTKAMTNERRLQLEQYLQQIVSDPVVTSSEIFMEYFKKLQMDTFNMPTVQLILRIY
MPDGAAVELDVQTSDSAERVLEAALFKLGVSRELGEYFSLFITHKEAKGPFTVVKRIAGF
ELPFLTIWNLEDDQFQIEVRKWYMNPSNDAMLMGSTEAIDLLYLQAVQEFQMEWTRPTKD
QQQKLQHCLKQQNKLKFLELMKTVEYYGYLHITSCTSDYPECDSEVTIWVGNNEMSCHFY
SPGGHAENLRLSIKDLICWNVTLLPKKQEVMSPNHQHLELKFDYQQGSSLKCITIHTEQA
FLLSSCLKKMLSERPVHRCKEELEIQVDKATCKSNIRPEQNGVHAKKQALLKDKREYCVV
DNISDLDL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcatatctgcattccagtcacagaggagctgcaggacacacttgggtgtcgctttgtg
ctctattccgtgtacctggaaggtttcctcctgtgtaaagtgcgatacaaagacctgcac
ctatggaatgaacagatttatcgagtgtttggaaatcgactgccaaaattcccaccaaaa
tattatctagctatgaccaaggctatgactaatgaaagaagattgcagctcgagcagtat
ctacaacaaattgtttcagacccagtggttaccagcagcgagattttcatggagtatttt
aagaaattacaaatggacacatttaatatgcccacagtacagctcatcctacgaatatac
atgccagatggagcagcagttgaattagatgtacagacttcagacagtgctgagagggtg
cttgaggctgcattgttcaaattaggtgtatccagagagttgggcgaatatttcagccta
tttattactcacaaagaagcaaagggacctttcacagtagtgaaacgaattgctgggttt
gaacttcccttcctaacgatatggaacctagaggatgatcagttccagattgaagtcaga
aagtggtatatgaatccctcaaatgatgcaatgctaatgggcagtactgaggctattgat
ttgctatatctacaggctgttcaagaatttcaaatggaatggaccaggccaacaaaggac
cagcagcagaaactccagcactgtttaaaacaacaaaacaaattaaagtttttggagctg
atgaagacggtggaatattacggatacctacacattacctcttgcaccagtgactaccca
gaatgtgattccgaagtcaccatatgggttgggaataatgaaatgagttgccacttttac
tctcctggtggccatgccgagaatttaagattaagcattaaggatttaatttgctggaat
gttacccttctccccaagaagcaagaagtcatgtctcccaatcaccagcacttggagttg
aagtttgattaccagcaggggtcttcattgaaatgcatcaccatacatacagaacaggca
ttcttactcagcagttgcttaaaaaagatgttatctgagcgccctgtccatcgatgcaag
gaggagctggaaattcaggtagacaaagcaacatgcaagtccaacataaggcctgagcag
aatggagtgcacgctaaaaagcaggcgttattaaaggacaagcgggaatattgtgtggta
gataatatttctgatctggatctgtaa

DBGET integrated database retrieval system