KEGG   Xenopus tropicalis (western clawed frog): 733728
Entry
733728            CDS       T01011                                 

Definition
(RefSeq) protransforming growth factor alpha-like precursor
  KO
K08774  transforming growth factor, alpha
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    733728
   04012 ErbB signaling pathway
    733728
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 733728
NCBI-ProteinID: NP_001037963
Xenbase: XB-GENE-5893023
UniProt: Q28H10
LinkDB
Position
7
AA seq 139 aa
MYGVLTFLLAGIPVCLSENFTAGMQNSSFVPESFTQSMFAECPDKYTSFCYHGTCRFLIS
QWEASCMCFNGYIGSRCQYVDLMKVMALDPRSFAVAAISVTLLVALSLIGSMCLGIYLCR
VKSEMSRISLLKNMESQDV
NT seq 420 nt   +upstreamnt  +downstreamnt
atgtatggagtgcttacatttctgctggcaggtattccagtctgtttgagtgaaaacttt
actgctggaatgcagaactcatcatttgtgccagagtccttcacccagagcatgtttgct
gaatgtccagataaatacaccagtttctgttatcatggcacatgccggttccttatatct
cagtgggaggcttcttgcatgtgcttcaacggttatattggaagccgttgtcagtatgta
gacctgatgaaggttatggcattagaccctcgctcattcgctgtagcagccatatctgtc
actttattggttgcactgtcattgataggaagcatgtgccttggtatctacttgtgtaga
gtaaagagtgaaatgagccggatttctcttctgaaaaacatggagagtcaagatgtttag

DBGET integrated database retrieval system