KEGG   Xenopus tropicalis (western clawed frog): 733847
Entry
733847            CDS       T01011                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand precursor
  KO
K05461  KIT ligand
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    733847 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    733847 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xtr04052]
    733847 (kitlg)
Cytokines and growth factors [BR:xtr04052]
 Growth factors
  Growth factors (RTK binding)
   733847 (kitlg)
SSDB
Motif
Pfam: SCF LapA_dom VSP FtsX DUF4436
Other DBs
NCBI-GeneID: 733847
NCBI-ProteinID: NP_001039061
Xenbase: XB-GENE-490160
UniProt: Q28DP4
LinkDB
Position
3
AA seq 258 aa
MKKTKTWIIICIYLQLFLHCFGNPCGNPITDAVNDIQKLVGNLPNDYIMNLKYVPKKEGL
PKHCWLYMMVVEMTRHLDNLLTKFENTSQNFLIIKNLSLILQGIRICIRLNDEMDFDSVS
SLYQVEGFKPRDFFNYVTSTIEVFKEINNTEYTGTCVLPTEYDFEYNTEDDSHSTNHDLP
YVPSTRKNSSRIDSSARSGFNTGASIQYSTVLIALACLVIGFLLGVVCWWKFKHRQTQTQ
NNLSEVAVEPRAENESQQ
NT seq 777 nt   +upstreamnt  +downstreamnt
atgaagaagacaaaaacttggattatcatatgcatatatcttcaactgtttctccattgc
tttgggaatccgtgtggaaatccaatcactgatgctgtaaatgacattcagaaactggta
ggaaatctcccaaatgattacattatgaatttgaaatatgttccaaaaaaggagggtctg
ccaaagcactgttggctgtatatgatggtggtcgaaatgactcgtcacctggataactta
ttaacaaaatttgaaaatacatcacagaattttctgattataaagaatctttccctgatt
cttcaaggcatcagaatttgtatccgactcaatgatgaaatggactttgactcggtctct
tctttatatcaagtagagggatttaaaccccgagattttttcaattacgtaactagtact
attgaggtttttaaggaaatcaacaacacagagtatacaggaacatgtgtcctgcctaca
gaatatgattttgaatataatactgaggatgattctcatagcacaaatcatgatctacca
tatgttccaagtacacgaaagaatagtagcagaattgattcatctgccaggtctggattc
aacactggtgcatctatacagtacagtacagtgttaatagcactggcctgcctagttatt
ggattcttattaggagttgtgtgctggtggaagtttaaacacagacaaacccagacacaa
aataacttgtcagaggttgcagtggaaccgagagctgaaaatgaatcacaacagtga

DBGET integrated database retrieval system