KEGG   Xenopus tropicalis (western clawed frog): 734123Help
Entry
734123            CDS       T01011                                 

Gene name
rhag, cd241, rh2, rh50, rh50a, rh50gp, slc42a1
Definition
(RefSeq) Rh-associated glycoprotein
  KO
K06580  ammonium transporter Rh
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    734123 (rhag)
   04090 CD molecules [BR:xtr04090]
    734123 (rhag)
Transporters [BR:xtr02000]
 Solute carrier family (SLC)
  SLC42: Rh ammonium transporter
   734123 (rhag)
CD molecules [BR:xtr04090]
 Proteins
  734123 (rhag)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ammonium_transp
Motif
Other DBs
NCBI-GeneID: 734123
NCBI-ProteinID: NP_001039257
Xenbase: XB-GENE-5797751
UniProt: Q3BBY0
LinkDB All DBs
Position
Un
AA seq 473 aa AA seqDB search
MSIVFNPSVRCQLPVLLLLLQGILIGLFAVFLSYDELSSATSLANITVANTHDLDTYFPL
FKDVQLMLFVGLGLLLSFLKLYGFGAMALNLVIANFSIQWAVLVQGFFYHYRDGKIHFGL
ENVMHAEFAAVTALISAGAILGRSSPVQLLLMSMLEIPLFVLNDWLINYYFHIIDIGGTV
AIHVFSCYFGLGVSRILYRPGLRAGHSKNITTSTTDLLSLLGSIILWIFWPSFNSVLAKS
AEARHRAVLNTFLALSFSTLTTFAVSSLMDKRGRINLVHLQNSILAGGVAVGASADMMIT
PAGASGLGCIAAFSCILGFQYISPFLERKLKVQDQCGIHNLHGLPAIFGTLGSILAILLD
RVDTGGHNLHTGFTPDISIGKESLILDEVEVNGAWNATDQALNQAAALGVTFGVSLLGGY
ITGLLIKPPCLVHPSDEMCFDDQPYFQIPIDSEEKWSLNPKAQRELLVPLKQV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagttttcaacccaagcgttcgctgccagctacccgttcttctgctcctgctc
caagggatactgattggcctctttgcagtgtttctgagctacgatgaactctctagcgcc
acatctctcgccaacatcacggtggcaaacacacacgacctggacacctattttcccctc
tttaaagatgttcaactcatgctgtttgttggacttggacttctgctctcgtttctcaag
ctttatggttttggggccatggccctcaacttggtcatagccaatttctccatccagtgg
gctgtgcttgtacaaggctttttctaccattacagagatgggaagatccactttggcctg
gagaatgtgatgcatgctgaatttgctgctgtcacggcccttatctctgctggggccatt
ctgggaagatccagccctgtccagctgctgttaatgtccatgctagagattccactcttt
gtgctgaacgactggcttattaattattatttccatataattgatataggaggtacagtt
gccatccatgttttctcttgttattttggcctgggtgtttctcggatactttaccgccct
gggctacgagcaggtcactcaaaaaacattacaacctccaccactgacctcctgtcgctg
ttggggtcaattatcctttggatcttctggccaagcttcaactctgtcttagccaagtca
gcagaggctcggcacagagcggttcttaacacatttcttgcacttagctttagcaccctc
actacctttgctgtgtctagcctaatggacaagagaggacgtatcaacttggtgcatcta
cagaattccattttggctggaggagtggctgttggagcttctgccgacatgatgattacc
ccagcaggggcttctggcttgggatgcattgcagctttttcctgtattctgggtttccaa
tacatctctcccttcctagaaagaaaactcaaagtacaagaccagtgcggaatccataac
ctgcatgggctgccagcaatctttggcactctgggcagcattttagccattcttttggac
agggtggacactggcggtcataatttgcacacaggcttcactccagacatttctataggg
aaagagtcgttaatccttgacgaagtggaagttaatggagcctggaatgcaactgatcaa
gcactgaatcaggcagctgccctaggggttacctttggcgtgtcgcttcttggaggttat
attactgggctccttataaagcccccttgtctcgtccatccatctgatgaaatgtgcttc
gatgatcagccctacttccagattcccatagactcagaagaaaaatggagcttaaatcca
aaagcccagagagaactgttagtgccactgaagcaagtgtag

DBGET integrated database retrieval system