KEGG   Xenopus tropicalis (western clawed frog): 734138Help
Entry
734138            CDS       T01011                                 

Gene name
tmed1, Xp24g1, Xp24gamma1
Definition
(RefSeq) transmembrane p24 trafficking protein 1
  KO
K20348  p24 family protein gamma-1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    734138 (tmed1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    734138 (tmed1)
Membrane trafficking [BR:xtr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    734138 (tmed1)
Transporters [BR:xtr02000]
 Other Transporters
  Others
   734138 (tmed1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 734138
NCBI-ProteinID: NP_001039263
Xenbase: XB-GENE-1017173
UniProt: Q28BQ6
LinkDB All DBs
Position
3
AA seq 220 aa AA seqDB search
MAWSSSFLFIVLPLAAAVAVQPQDTELTFLLPAGRQECFYQTTLYNGSMEIEYQVIGGAG
LDVDFSVTTPSGILLIMERRRSDGVHTVEPTEAGDYMICFDNSFSTISEKLVFFELIFDN
QQGDEEPDSWADVVEPDELLDIKLEDIKESIESVKSRLERSIQMQTVLRAFEARDRNLQD
SNLERVNFWSAINVGVLVTVAFLQVYMLKSLFDDKRKIRT
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcttggtcaagcagcttcttatttattgtgctgccgctggccgccgccgttgctgtc
cagcctcaggataccgagctcaccttcctgctgccggcggggagacaagaatgtttctac
cagaccacgctgtacaatggcagtatggagatagagtaccaggtgatcggcggtgctggc
ctagatgtggacttctcggtcactactccctcggggatcttgcttatcatggagagacgg
cgatcggacggcgtgcataccgtggagccgaccgaggctggtgactacatgatctgtttc
gataactccttcagcaccatctcagagaaactggttttctttgagctcatattcgacaat
cagcagggggacgaggagccagatagctgggcggacgtcgtggaacctgatgagcttctg
gacataaagctggaggacatcaaggagtccatagagagcgtgaagtccaggctggagcgc
agtatccaaatgcagacggtacttcgcgccttcgaggcgcgagatcggaacctccaggac
agcaacctcgagagagtgaacttctggtcagccatcaacgtcggcgtgttggtcacggtg
gccttcctgcaggtgtacatgctgaaaagcctcttcgacgacaagcgcaagatccggact
taa

DBGET integrated database retrieval system