KEGG   Xenopus tropicalis (western clawed frog): 779615Help
Entry
779615            CDS       T01011                                 

Gene name
gpd2
Definition
(RefSeq) glycerol-3-phosphate dehydrogenase 2
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    779615 (gpd2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     779615 (gpd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 EF-hand_1 FAD_binding_2 EF-hand_6 Pyr_redox_2 GIDA FAD_oxidored EF-hand_8 EF-hand_5 EF-hand_9 HI0933_like FAD_binding_3 Pyr_redox Pyr_redox_3 NAD_binding_8 Thi4 Gly_acyl_tr_N EF-hand_4 EF-hand_10 MTBP_mid
Motif
Other DBs
NCBI-GeneID: 779615
NCBI-ProteinID: NP_001107700
Xenbase: XB-GENE-1011134
UniProt: A8KBC3
LinkDB All DBs
Position
9
AA seq 725 aa AA seqDB search
MAFRNVVRGTLLIGGGAVATVFGLSHLTDKRKASITSVEAAELIKSSTQNELPSREAQLL
TLQKTKEFDVLVIGGGATGCGCALDAVSRGLKTALVERDDFSSGTSSRSTKLIHGGVRYL
QKAIMNFDIEQYKLVKEALHERANLLEIAPHLSAPLPIMLPVYKWWQLPYYWVGIKAYDL
VAGSQCLRSSYILSKSKALELFPMLQKDKLVGAIVYYDGQHNDARMNLAIALTAARYGAA
TANYTEVVRLLRRTDPESGKERVCGARCRDVLTGQEFDVRAKCVINATGPFTDSVRRMDN
QEVKNICQPSAGVHIVMPGYYSPDNMGLLDPATSDGRVIFFLPWEKMTIAGTTDTPTEVT
HHPIPTEDDINFILTEVRNYLSSDVEVRRGDVLAAWSGIRPLVTNPNSKDTQSISRNHVV
DVGESGLVTIAGGKWTTYRSMAEDTLDAAIKAHNLKAGPCRTVGLFLEGGKDWSPTLYIR
LVQDYGLESEVAQHLAATYGDQAFEVAKLAKVTGKRWPIVGKRLVSEFPYIEAEIKYALR
EYACTAVDVISRRTRLGFLNVQAAEEALPRIVDIMAKELNWKEQKKKEELEAAKNFLYYE
MGYKSRSEQLTDRSEINLSPSDVDRYTKRFHKFDKDKKGFITILDVQRVLENVNVQMDAN
NLHEILNEVDLNKNGQVELNEFLQLMSAIQKGFVSSSRLAILMKSAEENLDQRDPIPVHR
SGGGV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atggcttttcggaatgtggttagaggaacgctgttaattggcggaggtgctgtagctaca
gttttcgggctgtcccatttaacagacaagaggaaggcaagcataacttctgtggaagcc
gctgaactcattaagtcatccacccaaaatgagctgccctcgagggaggcccagctgctg
acactacagaaaacaaaagaatttgatgtgttggtcattggtggaggagccaccggctgc
ggatgtgcattggatgcagtcagtagaggcctaaagactgcccttgtggaaagagatgac
ttctcctcggggacaagcagtagaagcactaaactgatacatggcggcgtccgatatttg
cagaaagccataatgaacttcgatattgagcagtataaacttgttaaagaagctctccat
gaacgtgccaaccttctagaaatcgcacctcatttgtccgcacctttacccataatgctg
cctgtttacaaatggtggcagttgccttactactgggtcggaataaaggcctatgatctt
gtggccggcagccagtgcctgaggagcagctacatcctgagcaagtctaaagccttggag
ctcttccccatgctgcagaaagataaactggtcggggcaattgtctattatgatggacaa
cacaacgacgcacggatgaacctcgccatcgccctcactgctgccaggtatggtgctgcc
acagccaattacactgaagtggtacgcttgctgaggaggacagatccggagagcggcaag
gagcgcgtctgcggtgcacgctgcagagatgttctaacagggcaagaatttgacgtcaga
gcaaaatgcgtcatcaacgctaccgggcctttcaccgactctgtgcgcagaatggacaat
caggaggtcaaaaacatctgtcagcccagtgctggcgtgcatattgtgatgcccggatac
tacagtccagacaacatgggactacttgatccagccactagcgacggtcgggtgattttc
tttctaccgtgggagaagatgaccattgccggaacaaccgacaccccaacagaggtcacc
caccaccccattccaacagaagacgatatcaattttatattaacagaagtgcgcaactac
cttagcagcgacgtggaagtacgaagaggagatgttcttgcagcctggagcggcattcgt
cccttggtcacaaatcccaattccaaagacacgcaatcaatatcccgtaaccatgttgtt
gacgttggtgagagtggtcttgtcacaatagcaggtgggaagtggaccacttatcgctca
atggcggaagacacattggacgcagcaataaaagcgcacaatttgaaagcagggccatgc
agaaccgtggggcttttcctcgaaggggggaaggattggtcccccaccctttatatccgt
cttgttcaagactatgggcttgaaagtgaggtggctcagcatcttgccgctacctacgga
gaccaggccttcgaggtggccaaattggccaaagtcacagggaagagatggccgattgtt
gggaagcggcttgtttcagaatttccgtacattgaagctgagataaaatacgcactaaga
gaatacgcctgtacagcagtcgatgtcatttcccgccgcactcgcctagggtttctcaat
gtccaggctgctgaagaagccttaccacgaatagtagatatcatggccaaagagcttaac
tggaaggagcaaaagaaaaaggaagaattggaagcagcaaagaattttttgtattatgaa
atgggatacaaatctcgatctgagcagctaacggaccgatctgaaattaatctgtcaccc
tctgacgtggacaggtatacaaagagatttcataagtttgataaggacaagaagggattt
atcaccatactggacgttcagcgtgttctggagaatgttaacgttcagatggacgccaac
aatctgcacgagatcctgaatgaagttgatctgaataagaacgggcaagtggagctcaat
gagttcttgcagcttatgagcgccattcagaaaggcttcgtgtcaagcagccgcctggca
attctcatgaagagcgcagaagagaacctggatcaaagagaccctattcccgtgcatcgc
agcggtggcggagtgtga

DBGET integrated database retrieval system