KEGG   Xenopus tropicalis (western clawed frog): 779777Help
Entry
779777            CDS       T01011                                 

Gene name
slc35f1, slc35f2
Definition
(RefSeq) solute carrier family 35 member F1
  KO
K15287  solute carrier family 35, member F1/2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    779777 (slc35f1)
Transporters [BR:xtr02000]
 Solute carrier family (SLC)
  SLC35: Nucleoside-sugar transporter
   779777 (slc35f1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SLC35F CRT-like EamA DUF809
Motif
Other DBs
NCBI-GeneID: 779777
NCBI-ProteinID: XP_017949799
Xenbase: XB-GENE-5866569
LinkDB All DBs
Position
5
AA seq 354 aa AA seqDB search
MIPEQTNHVVSTIENLPAESISASPGPLHRMRNVFSREMLLSVALGQVLSLLICGIRLTS
KYLSEDFHANTPLFQSFLNYILLFLVYTTTLAVRQGEENLLAILKRRWWKYMFLGIIDIE
ATYLVVKAHQYTTFISIQLLNCFVIPVVILLSWFFLLVRYKVLHFIGAIACILGIGCMAG
ADVLMGRQQKEDFYPGDSKLIGDVLVLGGATLYGISSVCQEYIVRNLSRVELLGMIGLFG
SFFSGIQLAIMEHKELLKVPWDWQIGLLYVGFTACMFGLYSFMPVVIXKNKCHCNQPFHV
NSRTLHFFLRPLLVPLQVFRAVSTFLLHNPAWAGLLFLHQYICRPGPKSVQAVP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgattcctgagcagacaaaccatgttgtatccaccatcgagaacctgccggctgagagc
atctctgctagccccggccccctgcacaggatgaggaatgtatttagcagggagatgctg
ctctctgtggctctcggccaagtattatccttacttatttgtggcatcagactaaccagc
aagtacttgtcagaggattttcatgccaatacaccgctcttccagagtttcctcaattat
atcttactgttcttggtgtacactaccacattggctgtgagacaaggggaggaaaattta
ttggcgattttgaaaaggagatggtggaagtacatgtttttaggaatcatagacatagaa
gccacatatttggtggtaaaagctcatcagtacaccactttcattagtatacagttactg
aattgttttgtcattcctgtggtcatattactctcctggtttttcttactggtgcgatat
aaagttttacatttcattggtgccattgcctgtatattaggcattggctgcatggcagga
gctgacgttcttatgggaagacaacaaaaagaagacttctatccaggagacagcaaactg
attggggatgttttagtattaggaggtgccacactctatggaatttcgagtgtatgccag
gagtatattgtaagaaacttaagccgggtcgagttactaggcatgattggtctctttgga
tctttcttcagtggtatccagctagcaataatggaacacaaggagctgttaaaggtacca
tgggactggcaaataggattactgtatgttggcttcactgcctgcatgtttggcctctat
agcttcatgcctgtggttatcnaaaaaaacaagtgccactgcaatcaacctttccatgtt
aacagcagaactctacacttttttctgcggcctcttcttgttccattacaagttttcagg
gctgtatctactttccttcttcacaatcctgcttgggctggtcttttatttctccaccaa
tacatatgtcgcccaggacccaagagtgtacaagcagttccgtaa

DBGET integrated database retrieval system