KEGG   Xenopus tropicalis (western clawed frog): 779858Help
Entry
779858            CDS       T01011                                 

Gene name
gpx7
Definition
(RefSeq) glutathione peroxidase 7
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00480  Glutathione metabolism
xtr00590  Arachidonic acid metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    779858 (gpx7)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    779858 (gpx7)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     779858 (gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-GeneID: 779858
NCBI-ProteinID: NP_001072404
Xenbase: XB-GENE-940915
UniProt: Q0IIT7
LinkDB All DBs
Position
4
AA seq 184 aa AA seqDB search
MYLTALVLLLLLPPSLQKSRDFYTFKVVNIRGKLVSLEKYRGSVTLVVNVASECGFTDSH
YKALQQLQRDLGSYHFNVLAFPCNQFGQQEPNSDREIENFVRKNYSASFPMFSKTAVTGT
GVNSAFKYLIESSGKEPDWNFWKYLVGPDGKVVDAWGPSVSVAEVRPHITSLVRKIILKR
KEEL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgtatctaacagctcttgttctgcttctcttgttgcccccctcactgcagaaatcccgg
gatttctatacatttaaggtggtaaatatcaggggcaagctggtgtcgctggagaagtac
cgtggttcggtaaccctggtggttaatgtagcaagtgagtgtggatttacagattctcac
tacaaagcattacagcagctgcagagggacctgggatcttaccacttcaatgttttggca
tttccatgcaaccagtttggacagcaagaaccaaatagtgaccgagaaattgagaacttt
gtcagaaagaattatagtgcatcctttcccatgttcagcaaaactgctgtcactggcact
ggtgtcaacagtgccttcaagtacctaatagaatcctctggaaaagaaccggactggaac
ttctggaaatacttggttgggccggatggtaaagtagttgatgcttggggtccatcagtc
tctgtagcagaggtgaggcctcacatcaccagccttgtgaggaaaataattctgaaaagg
aaagaggaactttga

DBGET integrated database retrieval system