KEGG   Xenopus tropicalis (western clawed frog): 780106Help
Entry
780106            CDS       T01011                                 

Gene name
setd1b
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    780106 (setd1b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    780106 (setd1b)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     780106 (setd1b)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     780106 (setd1b)
   HMT complexes
    COMPASS/SET1 complex
     780106 (setd1b)
    COMPASS/SET1 complex (yeast)
     780106 (setd1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 SGP RRM_5
Motif
Other DBs
NCBI-GeneID: 780106
NCBI-ProteinID: NP_001072649
Xenbase: XB-GENE-5842344
UniProt: Q08D57
LinkDB All DBs
Position
1
AA seq 1956 aa AA seqDB search
MSFKEAKPGERGKNPEDHGRKQTASWINGMEAGNQPSTSGEKKSHHWRSYKLIIDPALRK
GQHKLYRYDGLSFSMPNSGVPPVDSVRDPRIGRIWTKTKELDLPVPKLKIDEFYVGPVPP
KQVTFAKLNDNIRENFLGDMCKKYGEVEEVEILYNPKNKKHLGIAKVIFASVKGARDAVK
HLHNTSVMGNIIHVELDTKGETRMRFYDLLVNGFYTPQTLPVGSDLDASPTVNETPQVVE
SVKRTKETAIGPSVTPNSSTPFSHDTAYSSSRQGTPNSYSQFTPQSQGTPHTPRLGTPFS
QDSSYSSRQTTPAFHYGQDSGFKPRRHENKFTDAYNRRPGHHYVHSSGSYRGTEHTFNVT
RPQPEPVQVPRTPPLSHSSGNYKSAFSPYQGNTVFPQTDESQYPQTSRDMEYRRTGPQTS
DSYSDAGCNSASLELKPVKEKPEEPPPPEPDSTTEQKASFSQTPERCETPGTPTLEAELQ
HNSLDTRIAMLLKEQRTQLHLIAGDQNSDNEIRMEGSPISSSSSQLSPIPPYSSGSRYQD
VTPSSRPSSTGLEDISPTPLPDSDDDDEPIPGTASLCQNSRSASPIDQINQSGRKTESLD
KKELVAGDETPTSEKMDEGHPSSGEDMEISDDEVTPSPITSAECAITSSSVISSVIPIPP
PGFPPLPPPPPPQPGFPMPPPLPPPPPPTHPSVTVPPPPLPAPPGVPPHHILHHPPPYHH
FPVMQGEMMNVLGNHWGGMTMSFQMQTQMLSRMMQGQGSYPYHHFMGGSMQFGNQHPYRP
FAISAHLTRGQPWPPFPKFDPSVPPPGYEHKKEDPHKATVDGVLQVIVKELKAIMKRDLN
RKMVEVVAFRAFDEWWDKKERLAKQSLTPVKSGESKEEDKQKTKEHITSSLLESWNKGEG
LGFEGIGLGIGLRGAIRLPSFKVKRKEPPDAALAGDQKRIRPSHSVDDEDEESERDRDIS
STASDLSKKDADAVNNRRRPARPLDSEGEEEVESEGDDGETSDKEDSSSEKEDQDDGSVS
ALSSKKQLYGDKEGDDEDDDTQSSGKEEDLVSEEEDTTSVASSRAEMDSSDESEESSEYE
SSSDSDEKEEEDDEEEELVFGDDQSEDQDLGQEYEVETDREEDFFRENLSECSSLPKAGD
VELEDEMQKVEEDVARQTTQETLHLRKKNLDVPLVESKECKQDTLDKVEKLFAVPMQEEV
FKEHEKAPSPMNEEEEYIELQLEPVPLVPEGAAPAAQEPVIIRPLTPTGAFGETGPVLKL
EEPKLQVNLTQFATEDEELYPRTPGRDTAAHSDTEVTFQPGLKVAPSSLPFLPSHNKEEE
CLLPPEKHAGHLTVTKMLSEEDLPRTPGRDIVVKSSHLGKSQSTETVPATPGSDAPLTGS
SLTLTSPHIPGSPFSYLSQSPGIINSGIPRTPGRDFNFTPTFPESNSIFPCHPSGKKPSV
DEPDEKSFKEPTSASLTMNSVPSPIPFASPPRGLPHMDIRLGADDLESSDTPAYLSDKLL
SEESECEFTKVHLTSTDESAPSPPLPPAEKRKGDRSKKPLSAHEFETEKNYETSSAVAMS
EGALGKQMFIGQPDAVSGIKDPAAVPLDFRNDSLSENTVHEPIIQKVPLKELENQWNEVL
KEEEDITKHKKSRNSRHNNRYDEFSTVPSPEFSPPRAMFKPRSEFEEMTILYDIWNGGID
DEDIKYMCITYDRLLQQDNGMDWLNDTLWVYHPSTSVYSPKKKKRDDGLREHVTGCARSE
GYYKIDKKDKLKYLINNRSLTEELPIDTQGKSIPAQPQASTRAGSERRSEQRRLLSSFTG
SCDSDLLKFNQLKFRKKKLRFCKSHIHDWGLFAMEPIIADEMVIEYVGQNIRQVIADMRE
KRYEDEGIGSSYMFRVDHDTIIDATKCGNFARFINHSCNPNCYAKVITVESQKKIVIYSK
QYINVNEEITYDYKFPIEDVKIPCLCGAENCRGTLN
NT seq 5871 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcaaggaggccaagcctggggagagaggcaagaacccagaagaccatggcaga
aagcagactgcaagctggatcaacgggatggaggcaggcaaccagcccagtacttcgggc
gagaagaagagtcaccattggcggagttacaagttgatcattgaccctgctctgaggaag
gggcagcacaaactctatcgttacgatgggctcagctttagcatgcctaactccggggtc
ccccctgtggattcagtaagagatccccggatcggacgtatatggaccaaaactaaagag
ttggatttgcctgtccccaaacttaagatcgatgagttttatgtggggccagtgcccccc
aagcaggtgacgtttgccaaactaaacgataacatccgcgaaaacttcctgggggacatg
tgcaagaaatacggggaggtggaggaggtggagatcctttataaccccaaaaataaaaaa
cacctgggcattgccaaagtcatattcgccagcgtgaagggcgccagggacgcggtgaaa
cacttgcacaacacctcggtcatgggcaacatcattcacgttgagctggacacgaaaggg
gaaacgcgtatgcgcttctatgaccttttggttaatggtttctatactcctcagactctt
ccagttggaagtgatttggatgcctctcccactgtgaatgaaacaccacaggttgtcgag
tcagtgaaacgtaccaaggagactgccattggtccatcagttaccccaaatagcagtact
ccattttcccatgatacagcctattcaagctctcgacaaggtacacctaattcttacagc
cagtttacaccacagtcgcaagggactcctcatactccccgcttgggaacccctttctcg
caggattccagttattccagtcggcaaacaacaccagcttttcattatggacaagactct
ggttttaaaccaaggagacatgaaaataagtttacggacgcttacaatagaagaccaggc
caccactatgtacacagttctggatcctaccgggggactgaacacacatttaatgtgacc
agacctcaaccagaacctgtgcaggttccccgcacaccacctttgagtcattctagcggg
aattataaatccgcattttcaccttatcaaggaaatactgttttccctcaaacagatgag
agccagtatcctcagacatcaagggatatggagtacagaaggacagggcctcagacgtca
gactcctattctgacgcagggtgtaactctgccagtttagaactgaaaccagtaaaggag
aaaccagaggaaccaccacctccggaacctgactcaaccacagagcaaaaagcatcattt
tcccagaccccagagaggtgtgagacacctggaactccaactctggaggctgaactgcag
cacaacagtttggatacacgaattgcaatgctattaaaagagcaaaggacccagctgcat
ttaattgctggtgatcaaaattcagacaatgaaataaggatggagggaagtccaatatca
tcctcctcctctcagctctccccaatccctccttatagttcaggctcccgttaccaggat
gttaccccttcatcacggccctcaagcacaggattagaagatattagtccaacccctttg
ccagattctgatgatgacgatgagccgattcctggcactgcctcactctgtcagaactca
aggtcagcatctcccatagaccagattaatcagtctgggcgaaaaactgagagtttggat
aagaaggaacttgtagcaggtgatgaaaccccaacatctgagaaaatggatgagggtcat
ccttcctcgggagaggacatggagatctcagatgatgaagttaccccttctccaataaca
agtgcagagtgtgccataaccagttcctctgtcatttcctcagtcattcctattccacca
cctgggtttccccctctgccaccgccacctcctccacagcctggatttcccatgccacct
cctttaccccctccaccgcctcctactcatccatcagtaacagtaccaccacctccattg
cctgcaccacctggggtgcctccacatcacatattgcaccatccacctccatatcatcat
ttccctgtgatgcaaggagaaatgatgaatgtccttgggaatcattggggtgggatgaca
atgtccttccaaatgcaaactcaaatgctcagccgcatgatgcaagggcagggttcttac
ccctaccaccatttcatgggaggctccatgcagtttggtaaccagcatccttatcgcccc
tttgctatatctgcacaccttaccagaggacagccctggccaccctttccaaagtttgat
ccatctgtaccaccaccaggctacgagcacaaaaaggaggaccctcacaaagcaacagtg
gatggagtcctgcaagttattgtcaaggaactgaaagctataatgaaaagagatctgaac
cgcaaaatggttgaggtggtggcttttagggcatttgatgaatggtgggataagaaggag
cgtttggcaaagcagtccttaacacctgtgaaatctggggagagcaaagaagaagataaa
caaaagacaaaggagcatataacttccagcctcttggaaagctggaacaaaggggaagga
ttaggttttgagggcattggactgggcattggtctgcgtggtgcaatccgacttccctct
ttcaaggtaaagcggaaagaacctcctgacgcggcactggctggagatcagaagaggatt
cgcccatctcattcagtagatgatgaggatgaagagtctgaaagagatcgagatatctct
agtacagcatctgacttatcaaagaaagatgcagatgcagtaaacaaccgaagaaggcca
gcaagacccttggatagtgaaggggaagaagaggttgaaagtgaaggggatgatggggag
acgtcagataaagaagactcctcttctgagaaagaggaccaagatgatggttctgtgtca
gctttgtccagtaaaaaacagctgtatggggataaagagggtgatgacgaagatgatgat
acacaaagcagtgggaaagaagaggatcttgtttcagaagaagaagataccaccagtgta
gcttcctctagagccgagatggattcttctgatgaaagtgaggaatcttcagagtatgag
tcaagctcggattcagatgaaaaagaggaggaagatgatgaagaagaagaactagtcttt
ggggacgatcaatctgaagatcaagatttaggacaggaatatgaagttgaaactgatagg
gaagaagatttcttcagagagaatttgtctgaatgtagtagtctaccaaaggcaggagat
gtggaattagaagatgaaatgcaaaaagtagaggaagatgttgcacggcaaacaacacaa
gagacattacatctgagaaagaaaaatctggatgtaccactggtggagtctaaagaatgc
aaacaggataccttagataaagtggagaagctctttgcagtacccatgcaagaggaagtt
tttaaggagcatgaaaaagcaccatcaccaatgaatgaagaggaagagtatatagagctt
caattagaacctgtgcctttggttccagaaggtgcagctccagctgcacaagagcctgtg
atcatccgtcccttaacaccaactggtgcttttggtgagactggtcctgttctcaagctt
gaagaacccaaactgcaagttaatttaactcagtttgccacagaagatgaagaactgtac
cctcgcacacctggccgggacacggctgctcattcagatacagaggtcacttttcagcct
ggtttgaaagtagccccatccagcctaccttttttgccaagccacaataaggaagaggag
tgtctgcttccacctgaaaagcatgccggtcatttaacggtgactaagatgctgtcggag
gaagatctgccccgtaccccaggcagagatattgtggttaagtcctcccaccttgggaag
tctcagagtactgagacagttcctgctacgcctggtagtgatgctcccctcacaggtagc
agccttacactgacttccccacacatacctggcagtcctttttcgtatctctcacagtca
ccaggaataattaacagtggtattccacggacacctggaagagattttaacttcactcca
acctttccagaatcaaattcaatattcccttgccacccttctggcaagaaaccctctgtg
gatgaaccagatgaaaagtcattcaaagaaccaaccagtgcttccttaacaatgaacagt
gttccttcacccatcccatttgctagcccgcctagagggcttcctcacatggacataagg
ttaggggcagatgatctggaatcatctgatactccagcatacctttccgataaattatta
agtgaggagagtgaatgtgaatttactaaagtgcacctgacttccactgatgaatctgca
ccatcaccacctctccctcctgcagagaagaggaaaggagacagatccaaaaaacctctt
tctgctcatgaattcgagactgagaaaaactatgaaacttcttctgctgttgccatgtca
gaaggtgctttgggtaaacagatgtttattggacaacctgatgcagtcagtggtattaaa
gatccagcagctgtaccgctagactttaggaatgatagcctctctgaaaacacagttcac
gagcccattattcaaaaagtccctttaaaagagctggaaaatcagtggaatgaagtttta
aaagaggaggaggatataactaaacataaaaaatcaaggaactccaggcataacaataga
tatgatgagttttcaactgtaccttctcccgaattttccccaccccgagctatgtttaaa
cctcgctctgaatttgaggagatgaccattctttatgatatatggaatggaggaatagat
gatgaagatatcaaatacatgtgcattacatatgatagactgttacagcaagataatggc
atggactggctcaatgacacattatgggtctaccacccttcaaccagtgtttattccccc
aagaagaagaagcgagatgatggtttacgggagcatgtaacaggatgtgctcgtagcgag
ggatattataaaattgataagaaagacaaacttaaatacctcatcaacaaccgttctttg
actgaagaacttcccatcgatacccagggaaagagtatcccagctcagcctcaagcctcc
acccgagcgggctcggaaagaaggtcagaacagcgcagactgctctcttccttcactgga
agctgtgacagcgacttgctcaaattcaatcagctgaagttccgaaagaagaagttgcgt
ttctgcaagagccatattcacgactggggtctttttgccatggaaccaattatagctgat
gagatggttattgagtatgtgggacaaaatattagacaggtaattgccgatatgcgggag
aagcgatatgaggatgaaggaatcggcagcagttacatgtttagggtggaccacgacacc
atcattgatgcgactaagtgtgggaattttgcacgatttattaaccacagctgtaatcct
aattgctatgcaaaggttattactgtggagtctcagaagaagattgtgatctactccaaa
cagtatatcaatgtgaatgaagagataacatacgattacaagtttcctatagaagacgtg
aagatcccttgtctttgtggagcagagaactgcagagggacgctaaattag

DBGET integrated database retrieval system