KEGG   Xylella taiwanensis: AB672_01690Help
Entry
AB672_01690       CDS       T05568                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
xtw  Xylella taiwanensis
Pathway
xtw00220  Arginine biosynthesis
xtw01100  Metabolic pathways
xtw01110  Biosynthesis of secondary metabolites
xtw01130  Biosynthesis of antibiotics
xtw01210  2-Oxocarboxylic acid metabolism
xtw01230  Biosynthesis of amino acids
Module
xtw_M00028  Ornithine biosynthesis, glutamate => ornithine
xtw_M00845  Arginine biosynthesis, glutamate => acetylcitrulline => arginine
Brite
KEGG Orthology (KO) [BR:xtw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AB672_01690
Enzymes [BR:xtw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     AB672_01690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: AXI82766
UniProt: Z9JJI9
LinkDB All DBs
Position
432602..433693
Genome map
AA seq 363 aa AA seqDB search
MSVLLDSTLNHLEQLVSFDTRNPPRAIGTDGIFSYVTAHLPGFHLETTDHGAGAVSLYAV
RGAPKILFNVHLDTVPDSPAWSADPHVMRRTADRVIGLGVCDIKGAAAALLAAVQASDGA
AALLFTSDEEANDPRGVAAFLKRGIPYEAVLVAEPTMSQAVLAHRGISAVSMTFTGCAGH
AAGEQPPAASALHQAMRWGVRALDYAASLAHERFGGLTGLRFNIGRLEGGIKANMIAPTA
EVRFGVRPLPSMDVDQLLATFAGFAIPAASFQETFRGPSLPSGGIAAAEARRLAARDVAE
VLGLPMGHAVDFWTEASLFSACGYTALVYGPGDIAQAHTADEFVTLQQLQRYAASVHRII
STS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgttgctggatagcaccctgaatcaccttgagcaattggtatccttcgatacc
cgtaacccgccgcgcgccatcggtaccgacgggatcttctcctatgtgacggcccacctg
ccgggcttccatcttgaaacgacggatcatggcgccggtgcggtcagcctgtatgccgtg
cgtggcgcccccaagatcctattcaatgtacacctggatacggtcccggattcgccggca
tggagtgcggatccacatgtgatgcgccgtactgcagatcgcgtcattgggttgggtgtg
tgtgacatcaagggcgctgcggcggcactgttggccgcggtccaggcgagtgatggcgct
gccgcgctcctgtttacctccgacgaggaggcgaacgatccgcgcggcgtcgccgccttc
ctgaaacgcggtataccttatgaagccgtcttggtggccgagccgaccatgagtcaagcc
gtgctggcacatcgcggtatcagtgcggtctcgatgacatttaccggctgcgccggtcat
gctgcgggcgaacaaccacccgctgccagtgccctgcatcaggcgatgcgctggggcgtc
cgtgcccttgattacgccgcctcattggcccatgagcgtttcggtggtttgacggggctg
cgtttcaacatcggacggctcgaaggaggtatcaaagccaatatgattgcaccgaccgcc
gaagtgcgttttggcgtccgtcccttgccatccatggatgtggatcaactcctggcgacc
ttcgctgggtttgcgataccggcggcgtccttccaagaaacgttccgcggacccagctta
ccgtccggtggtatagcagcggctgaggcgcggcggctggcggcccgtgatgtggctgag
gtactgggcttaccgatgggtcatgcggtggacttctggacagaggcttcactcttttcg
gcttgtggctacactgccctggtctacggaccaggagatattgcccaggcgcacactgcc
gacgaatttgtcacgctccagcagttgcagcgctacgccgcatcggtccatcgcatcatc
agtacctcgtaa

DBGET integrated database retrieval system