KEGG   Xylella taiwanensis: AB672_07820Help
Entry
AB672_07820       CDS       T05568                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xtw  Xylella taiwanensis
Brite
KEGG Orthology (KO) [BR:xtw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AB672_07820
Enzymes [BR:xtw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AB672_07820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 DAO Thi4 HI0933_like NAD_binding_8 Glutaredoxin NAD_binding_7 FAD_binding_3 FMO-like AlaDh_PNT_C K_oxygenase Thioredoxin_4 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AXI83844
UniProt: Z9JGP3
LinkDB All DBs
Position
complement(1805556..1807145)
Genome map
AA seq 529 aa AA seqDB search
MFDESLKTQLKAYLDRVIRPIHIHASVDESQKSREMLELLENIVLLSDKVVLEVQRDDDQ
RKPSFALGTPGEDISMRFAGLPMGHEFASLVLGLLQVGGHPPKVTDDLIERVRSLDGHYC
FETYFSVSCQSCPDVVQALNMAAVLNPRIEHVAIDGALFQDEVEARQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDIGAAKREAETIQAKAAFDVLVVGGGPAGAAAAVYAARKGIRTGL
VAERFGGQVLDTMTIENFISVPETDGPRMAVALEQHVRQYEVDIMNLQHAETLVPAGENG
LIEVGLASGVSLSSRTVILCTGARWRQMNVPGEDEYRNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIAAYVTLLEFDTKLRADEVLQRKLRSMSNVEIITGAQTTAVSGDG
KKVTGLVYVDRSTGGSFTLTLEGVFVQIGLLPNTEWLKGAVELSLRGEIVIDERGQTSMP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRTNVVGTTGIAQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatgaaagtttaaagacccagcttaaagcctatttggatcgggtgattcgtccc
atccatattcatgcctctgttgacgagagccagaagtcacgtgagatgctcgagctactc
gaaaatattgtactgctctcggacaaggtcgttttggaggtgcagcgtgacgatgatcaa
cgtaagccctcctttgcgttgggtacgccaggtgaggacatttcgatgcgctttgctggt
ttaccgatggggcacgagtttgcttcattggtgcttggattgctgcaggttggtgggcat
cctcctaaagtcacggacgatctaatcgagcgggtgcgcagcctggatggtcattattgc
tttgagacctatttttcagtgtcttgtcagagttgtccggatgtggtgcaggcactgaat
atggctgcggtattgaacccgcggatcgagcatgtagctattgacggcgcactgttccag
gacgaggtcgaggcacgccagattatgtcggtgccaacggtgtacttgaatggtgagctg
tttgatcaggggcgtatgacattggaacagattgtcgccaagcttgatattggtgcggcc
aagcgcgaagccgagactatccaagctaaggctgccttcgacgtactggtggttggtggc
ggcccggctggtgcggcagcggcggtgtatgctgcgcgtaagggaatccggactggtttg
gttgctgagcgctttggtggacaagtgctggataccatgacgatcgagaacttcatatct
gtgccggaaaccgatggcccgagaatggccgtggccttggagcagcacgtgcgccagtat
gaggtcgatatcatgaacttgcagcatgccgagacattggtgccggctggagaaaacggc
cttattgaggttggattggccagtggtgtttcgctgagcagccgcaccgtgattctttgc
acgggtgcacgctggcggcagatgaacgtgcctggtgaggatgaataccgcaacaaggga
gtggcttattgtccgcattgcgatggaccgttgtttaagggtaagcgagtcgcggtgatt
ggtggtggtaattcgggagtggaggcggcgatcgatttggctgggattgccgcctatgtc
acgttgcttgagttcgataccaagctgcgtgccgacgaagtattgcaacgtaagttacgc
agcatgtcgaatgtggaaattattacgggtgcccagaccaccgcggtgtctggtgatgga
aagaaggtcactggcttggtctacgttgatcgcagcactggtgggagctttacattgaca
ttggaaggcgtgtttgtgcagatcggtttgttaccgaataccgagtggttgaagggtgcg
gtggagttgtctctccgtggcgaaatcgtgattgatgaacgtggtcagaccagcatgccg
ggtgtattcgctgctggtgacgctactacggtgccgtataagcagattgtcattgcgatg
ggcgagggatccaaagccgcgttgagtgctttcgattatctgatccgtaccaatgtggtt
gggactacggggattgctcaggcagcttga

DBGET integrated database retrieval system