KEGG   Xanthomonas vasicola: C7V42_00865Help
Entry
C7V42_00865       CDS       T05388                                 

Definition
(GenBank) superoxide dismutase family protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
xva  Xanthomonas vasicola
Brite
Enzymes [BR:xva01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     C7V42_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu Big_3_5
Motif
Other DBs
NCBI-ProteinID: AVQ05429
UniProt: A0A315F9E8
LinkDB All DBs
Position
217120..217767
Genome map
AA seq 215 aa AA seqDB search
MRIVPTTLFLATALVLTACKRDEPAPAEPAPAPQASTPSEAAHGGEHAASMVTEAAATTT
ATAELKPTKGNDVKGTVTFKTVDGALRATGQLSGLKPNTEHGFHIHEKGDCSAPDGSSAG
GHFNPSQSAHGNVSTEPHHGGDMPNIKSDAQGNASIDGPVSSNVNLGKADQFDIAGHAVI
VHADADDYKTQPTGNAGGRLACGVITTDNAQAATK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattgttccgaccaccttgtttctggccaccgccctggtgttgactgcgtgcaag
cgcgacgagcccgcgccggccgagccggcacccgcgccgcaggccagcacgccgtccgaa
gcggcgcacggtggcgaacacgccgcctccatggtcaccgaagcggccgccaccaccact
gcaaccgccgagctcaagccgaccaagggcaatgacgtcaaaggcacggtgaccttcaag
accgtcgacggcgcactgcgtgccaccggtcagctgagtggcctcaagcccaataccgag
cacggcttccacatccacgaaaagggcgattgcagcgcgccagacggcagcagcgcgggc
ggccacttcaacccctcccagtccgctcacggcaatgtcagcaccgaaccgcaccacggt
ggcgacatgcccaacatcaagtccgatgcgcagggtaacgccagcatcgacggcccggtg
tcgagcaacgtcaatctcggcaaggccgatcagtttgatatcgccggccacgcagtgatc
gtgcacgcagatgccgacgactacaaaacccagcccaccggcaacgccggcggccgtctg
gcctgcggcgtgatcaccaccgataacgcgcaggcggcgaccaagtaa

DBGET integrated database retrieval system