KEGG   Xanthomonas vasicola: C7V42_04905Help
Entry
C7V42_04905       CDS       T05388                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xva  Xanthomonas vasicola
Brite
KEGG Orthology (KO) [BR:xva00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    C7V42_04905
Enzymes [BR:xva01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     C7V42_04905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like DAO FAD_binding_3 AlaDh_PNT_C NAD_binding_7 Glutaredoxin FMO-like Thioredoxin_4 K_oxygenase Thi4 NAD_binding_8 Spermine_synth
Motif
Other DBs
NCBI-ProteinID: AVQ06056
LinkDB All DBs
Position
complement(1084265..1085857)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDESPGSREMLDLLEELVLLSDKISLDIHRDDDQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAELIEQVQHLDGYYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGAWFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKEAFDVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLIPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLVEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYKDRTGGDIQHIDLEGVFVQIGLLPNTEFLRGTVALSPRGEIIVDDRGQTDVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDHLIRSSAPASADSVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatctcaagacccagctgaccgcctacctggaacgggtaacgcggccg
attcaaatcaacgcctcgatcgacgaaagccccggctcgcgcgaaatgctcgacctgctg
gaagaactggtgctgctgtcggataagatcagcctggacattcatcgcgacgacgaccag
cgcaagccgtcgttcgcgctgaccacaccgggccaggacatctcgctgcgctttgccggg
ctgccgatgggccacgagttcacctcactggtgctggcgctgctacaggtgggcggccac
ccgtccaaggccgctgccgagctgatcgagcaggtgcagcacctggatggctactaccag
ttcgaaacctatttctcgctgtcgtgccagaattgcccggacgtggtgcaggcgctgaac
ctggctgccgtgctcaacccgcgcatcaagcacgtggccatcgacggtgcctggttccag
gacgaagtggaaacccgccagatcatgtcggtgcccaccgtgtacttgaatggtgagctg
ttcgaccaaggccgcatgacgctggagcagatcgtcgccaagctcgacaccaacgccgcc
aagcgcgacgctgcgaagattgccgcgaaagaggcgttcgacgtgctggtggtgggcggt
ggcccggccggttctgcagcggcggtgtacgccgcacgcaaaggcatccgcactggtgtg
gccgccgaacgttttggtgggcaggtgctggacaccatgtcgatcgaaaacttcatctcc
gttcctgaaaccgaaggcccgaagatggccgccgcgctcgagcagcacgtgcgccagtac
gacgttgacatcatgaatctgcagcgcgccgagcagctgattccggccggtgccgatggt
ctgatcgagatcaagctggccaatggcgcttcgctcaagagcaagaccgtgatcctctcc
accggtgcgcgctggaggcagatgaatgtacccggcgaagatcagtacaagaacaagggc
gtggcgtattgcccgcattgcgacggcccactgttcaagggcaagcgtgtggcggtgatt
ggcggcggcaactccggggtggaagcggcgatcgacctggccggcatcgtggcgcatgtc
acgctggtggaattcgacgacaagctgcgcgccgacgaggtgctgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagcgcgcagaccaccgaagtgctcggtgacggg
cagaaggtgaccggcctggtctacaaggaccgcaccggcggcgatatccagcacatcgat
ctggaaggtgtattcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtggcgttgtcgccgcgcggcgagatcatcgtcgacgaccgtggccagaccgatgtgccg
ggcgtgttcgccgccggcgatgccaccacggtgccgtacaagcagatcgtgatcgcgatg
ggtgaaggttccaaagcggccctcagcgcattcgatcacctgatccgctccagcgcaccg
gccagcgccgacagcgtggcgcaggccgcataa

DBGET integrated database retrieval system