Xanthomonas vasicola pv. vasculorum: C7V42_05940 Help Entry C7V42_05940       CDS       T05388                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xva  Xanthomonas vasicola pv. vasculorum Pathway xva00998   Biosynthesis of various antibiotics xva01100   Metabolic pathways xva01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xva00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C7V42_05940   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C7V42_05940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 DUF1896 Motif Other DBs NCBI-ProteinID:  AVQ06221 LinkDB All DBs Position 1273926..1274165 Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKSHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcacctcggtgcagcaggcgatcgactacgtcaagtctcacgtcaagagctga

DBGET integrated database retrieval system