KEGG   Xanthomonas vasicola: C7V42_08665Help
Entry
C7V42_08665       CDS       T05388                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xva  Xanthomonas vasicola
Pathway
xva00380  Tryptophan metabolism
xva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xva00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    C7V42_08665 (kynU)
Enzymes [BR:xva01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     C7V42_08665 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVQ06672
UniProt: A0A315GHL0
LinkDB All DBs
Position
complement(1867717..1868988)
Genome map
AA seq 423 aa AA seqDB search
MTDLLSRAHADALDAADPLRSLRDAFVFPQHGNQDQIYFVGHSLGLQPRAARAMVDEVLD
QWGALAVEGHFTGPTQWLTYHQLVRDGLARVVGAHPGEVVAMNTLSVNLHLMMASFYRPT
PERGAILIEAGAFPSDRHAVESQLRLHGLDPATHLIEVEADEPNGTLSMAAIADAIAQHG
QRLALVLWPGIQYRTGQAFDLAEIVRLAQAQGAAVGFDLAHAVGNIPLTLHDDGVDFAVW
CHYKYLNAGPGAVGGCFVHTRHANYDLPRMAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLALFDQAGMAALRSKSEQLTGHLEQLIHARVPQVLQIVTPAEPARRG
CQLSLRVAGGRAQGRSLFEHLHAAGVLGDWREPDVIRIAPVPLYNRFRDLHTFVDQVEAW
AAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgctgtcccgcgcccatgccgatgcactggatgccgccgacccgctgcgc
agcctgcgtgatgcctttgtgttcccacagcacggcaatcaggatcaaatttatttcgtc
ggccattcgcttggcctgcagccgcgcgcggcgcgcgcgatggtggacgaggtgctggat
cagtggggcgcgctggcggtggaaggtcactttaccggccccacccaatggctgacctat
caccaactggtgcgcgacgggctggcccgcgtggtcggcgcgcaccctggcgaagtggtg
gcgatgaacactctcagcgtcaatctgcatttgatgatggcgagcttttatcgcccaacg
cccgaacgcggcgcaattctgatcgaagccggcgcgttcccatccgaccgccacgcggtg
gaatcgcagttgcgactgcacgggctggacccggccacgcatctgatcgaagtggaagcc
gatgaacccaacggcacgttatcgatggctgccattgccgatgccatcgcgcagcacggt
cagcgcctggcgttggtgctgtggccgggcatccagtaccgcaccggtcaggccttcgac
ctggccgagatcgtgcggctggcgcaggcgcaaggcgcggcggtgggctttgacctggcg
catgcagtgggcaacatcccgctgaccctgcacgacgatggcgtcgatttcgcggtgtgg
tgccactacaaatatctcaacgccggccccggcgcggtgggcggttgtttcgtgcacacg
cgacatgccaactacgatctgccgcgcatggccggctggtggggacatgagcagcagacc
cgattccgcatggacccgcagttcgtgccctcgcccggcgccgaaggctggcagctaagc
aacccaccggtgctggcgctggcaccgctgcgcgcatcgctggcgttgttcgatcaagcc
ggcatggccgcgctgcgcagcaaatccgaacagctcaccgggcatctggagcaattgatc
cacgcgcgcgtgccgcaggtgctgcagatcgtcaccccggccgagccggcgcgacgcggt
tgccagctgtcgttgcgggtggccggaggacgcgcgcagggacgctcgctgttcgagcat
ctgcatgcagccggtgtgctcggcgactggcgcgaaccggacgtgatccgcattgcgccg
gtaccgctatacaaccgcttccgcgatctgcacaccttcgtggaccaggtcgaagcctgg
gcggctgcctga

DBGET integrated database retrieval system