KEGG   Xanthomonas vasicola: C7V42_17595Help
Entry
C7V42_17595       CDS       T05388                                 

Definition
(GenBank) thiamine phosphate synthase
  KO
K00788  thiamine-phosphate pyrophosphorylase [EC:2.5.1.3]
Organism
xva  Xanthomonas vasicola
Pathway
xva00730  Thiamine metabolism
xva01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xva00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    C7V42_17595
Enzymes [BR:xva01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.3  thiamine phosphate synthase
     C7V42_17595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TMP-TENI OMPdecase Poxvirus_B22R_C TGT
Motif
Other DBs
NCBI-ProteinID: AVQ08149
LinkDB All DBs
Position
3868233..3868856
Genome map
AA seq 207 aa AA seqDB search
MPNRLNVRGVYLITPDEPNTQRLLLRTAPLLASITWLQYRNKQADAALRLRQASALHELC
AAHGVPLIINDDAQLAAQVGAQGVHLGEDDGDVAAARALLGEQAIIGVSCYDEIERARAA
AAAGASYVAFGAFFPTTTKQTTRRATPALLQRAAELHLPRVAIGGIAPAQVPALVTAGAD
LIAVVSGVYAAPDPVAAVQAYRAGFGS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaccgtcttaacgttcgcggtgtgtacctgatcaccccggacgagcccaacacg
cagcgcttgctcctgcgcacggcgccattgctggcgtcgatcacctggctgcaataccgc
aacaagcaagcggacgcggcgctgcggctgcgtcaggccagcgccttgcacgaattgtgc
gcggcacacggtgtgccattgatcatcaacgacgatgcgcagttggcggcgcaggtcggt
gcgcaaggcgtgcatctgggcgaagacgatggtgatgtagcggcggcacgcgcgctgctg
ggcgagcaggccatcatcggggtgtcgtgctacgacgagatcgagcgcgcgcgcgcggca
gccgcagcgggcgccagctatgtggccttcggtgcgtttttcccgaccaccaccaaacag
acgacacggcgtgccacgcctgcgttactgcagcgggccgccgaactgcacctgccgcgc
gtggcgatcggtggcattgcgcccgcgcaggtgcctgcgctggtgactgcgggtgccgat
ttgattgccgtagtcagtggcgtgtacgcggcaccggatccggttgctgcagtgcaggcg
tatcgcgcggggtttggttcttaa

DBGET integrated database retrieval system