KEGG   Xanthomonas vesicatoria: BJD12_01655Help
Entry
BJD12_01655       CDS       T04741                                 

Definition
(GenBank) autotransporter outer membrane beta-barrel domain-containing protein
Organism
xve  Xanthomonas vesicatoria
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S8 Autotransporter PATR OmpA_membrane
Motif
Other DBs
NCBI-ProteinID: APP74185
UniProt: F0BBS8
LinkDB All DBs
Position
complement(402761..405520)
Genome map
AA seq 919 aa AA seqDB search
MNRSLLATTIASCLVLTACGGGGGGGNVRNDPPQSTVIAPAPTPTAPTTPTTPGTTSDPL
PKTAPVPTPAPTRYQGVGSNLLVPINADLAQQAGARGQGVKLAVLDDNLVPSYAPIAGKV
DGFTDYTASPGTPESSSNALRGHGTIVSALVLGSAQDGFAGGVAPDADLFYARICAENSC
GTQQARRAAVDLAASGVRIANLSLGASYADAAGSANAAAAWRFALTPLVQADALIVASTG
NEGAAEASYPAATPVQEASVRNNWLAVGAINIDSAGNPAGLTSYSNHCGAAAQWCLVAPG
SFTAPALAGTELQGQVAGTSFSTAAVSGVAAQVLGVYPWMSASNLQQTLLTTATDLGDPG
VDALYGWGLVNAAKAIKGPGQFASNWAANVGAGYDSTFSNDISGSGSLTKNGSGKLTLSG
NNSYTGGTTVADGVLALSGSLRSDLLVANSATFESRGGVINGGYSLVNTTGTTAIELGKG
LTVTGVASLKGNLLLLPEAAGYTVGSSERIVNAGVLQGTFDRVQYANNFFWTASLAYDPT
TVTATLTRNAAAASAQAAGAPQAVVNGAAQADALVKVLDTRVASGDTANLGGLISATGSL
LAASNAQVAASLPTLAGQVHGIERTLGFQSALNDARVAADRLPYLADTTTLTTWMQGSYL
DGDLSRSGFASADYTQQATTFGVDLPVGNAGTVVGAAVTSGQDRAHIDASASRLRADRYA
MTAYLYQPIGQAYVSGIGSYGMSNVDTERNVQAGSVGERLQDRRHDTNWSLRAEVGLLPH
AGLSPFVAAGVVSQTQDAFSEASLTGLGLSAGSDTLRAGYGEVGVRGHLARGKWGFDGLV
AYRSLLGNPNADFTAWFTGLPEARFNVAGTPVSKQAVRASVGVRYQVNDAFSLYGNVGAE
RGRSDSNSINANVGLRWQF
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctcgctacttgcaaccaccatcgcctcctgtctcgtcctgaccgcatgtggc
ggcggcggtggcggcggcaacgtccgcaatgatccgccgcagagcaccgtgattgcgccg
gcacccacgccgaccgcacccaccacccccaccactccaggcaccacctccgacccgctg
cccaagaccgcgccggttccgacgcctgcgcctacccgctatcaaggcgttggcagcaat
ctgctggtgccgatcaatgccgatctggcgcaacaggccggtgcccgcggccagggcgtg
aagctggcggtgctggacgacaacctggtgccgagttacgcgccgattgccggcaaggtc
gatggcttcaccgactacaccgccagcccgggcacgcccgagtcctcgtccaatgcgctg
cgcggccatggcacgatcgtctcggcgctggtgctgggctcggcgcaggacggctttgcc
ggtggtgtggctccggatgcggacctgttctatgcacgtatctgcgccgagaattcctgc
ggcacccagcaggcccgccgcgctgcggtggatctggccgcctccggcgtccgcatcgcc
aacctgtcgctgggggcctcgtatgccgacgccgccggcagcgcgaacgcggcagcggcc
tggcggtttgcgctgacaccgctggtgcaggcagacgcgctgatcgtcgcctcgacaggc
aacgagggcgccgccgaagcctcgtacccggcggcaacgccggtgcaggaagccagtgtg
cgcaacaactggctggcggtgggcgcgatcaatatcgacagcgccggcaatccggccggc
ctgaccagctattccaatcattgcggcgccgctgcgcaatggtgcctggtggcaccgggc
agcttcaccgcgccggcgctggccggcaccgaattgcagggccaggtcgccggcacctcg
ttctccaccgctgcggtcagcggcgtcgcggcgcaggtattgggcgtgtatccgtggatg
agcgcctccaacctgcagcagaccctgttgaccaccgctaccgacctgggcgacccgggc
gtggatgcgctgtatggctggggcctggtcaacgcggccaaggcgatcaagggtccgggc
cagttcgccagcaactgggcggccaatgtgggtgcgggctacgacagcaccttcagcaac
gatatttccggcagcggcagcctgaccaagaacggcagcggcaaactcaccctgagcggg
aacaatagctataccggcggcaccactgtcgctgatggtgtgctcgcgctgtccggcagc
ctgcgctcggatcttctggtcgccaactcggccaccttcgagtcgcgcggcggcgtgatc
aacggcggctacagcctggtcaacaccaccggcaccaccgccatcgagttgggcaagggc
ctgaccgtcaccggtgtggccagcctgaaaggcaatctgctgttgctgccggaagcggcg
ggctacaccgtgggcagtagcgagaggatcgtcaacgccggggtcctgcaaggcacgttc
gaccgtgtgcagtacgccaacaatttcttctggaccgcgtcgcttgcctacgatccgacc
accgtcaccgcaaccctgacccgcaatgcggcagccgccagcgcgcaagccgccggtgcg
ccgcaggccgtggtcaacggtgccgcgcaggccgatgcgctggtcaaggtgctggacacc
cgcgtggcctccggcgacaccgcaaacctgggtggtctgatcagcgccaccggctcgctg
ctggcggcatccaacgcacaggtcgccgcatcgctgccgaccctggccggccaggtgcat
ggcatcgagcgcacgctgggcttccagtcggcactcaacgatgcacgcgtggctgccgac
cgcctgccctacctggccgacaccaccacgctgaccacctggatgcagggcagctacctg
gatggcgatctgagccgcagcgggttcgcctcggccgactacacccagcaagccaccacc
ttcggcgtggacctgccggtcggcaatgccggcacggtcgtgggcgcggcggtgacctct
ggccaggaccgcgcgcacatcgatgcatcggccagccgtctgcgcgcggaccgttatgcg
atgaccgcgtatctgtatcagcccatcggccaggcgtatgtgtcgggcatcggttcgtat
ggcatgagcaatgtggacaccgagcgcaacgtgcaggccggcagcgtcggcgagcgcttg
caggaccgtcgccacgacaccaactggtcgctgcgtgcggaagtcggcctgctgccgcat
gccgggctgtcgcctttcgtcgctgcaggcgtggtcagccagacccaggacgccttcagc
gaagcatcgctgaccggtctgggcctgagcgccggtagcgacaccttgcgcgcgggatat
ggcgaggtgggcgtgcgcggtcatctggcacgcggcaagtggggcttcgatggtctggtc
gcctaccgctcgttgctgggcaaccccaacgccgactttaccgcctggttcaccggcttg
ccggaggcgcgcttcaacgttgccgggacgccggtgtcgaagcaggccgtgcgcgcctcg
gtcggcgtgcgttatcaggtcaacgacgcgttctcgctgtacggcaatgtaggtgccgag
cgtggtcgttccgattccaacagcatcaacgccaatgtcggtctgcgctggcagttctga

DBGET integrated database retrieval system