KEGG   Xanthomonas vesicatoria: BJD12_02200Help
Entry
BJD12_02200       CDS       T04741                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00020  Citrate cycle (TCA cycle)
xve00190  Oxidative phosphorylation
xve00650  Butanoate metabolism
xve01100  Metabolic pathways
xve01110  Biosynthesis of secondary metabolites
xve01120  Microbial metabolism in diverse environments
xve01130  Biosynthesis of antibiotics
xve01200  Carbon metabolism
Module
xve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xve_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJD12_02200
   00650 Butanoate metabolism
    BJD12_02200
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BJD12_02200
Enzymes [BR:xve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BJD12_02200
    1.3.5.4  fumarate reductase (quinol)
     BJD12_02200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO
Motif
Other DBs
NCBI-ProteinID: APP74263
LinkDB All DBs
Position
complement(507474..509264)
Genome map
AA seq 596 aa AA seqDB search
MSAYKITEHKYDMVVVGAGGAGLRATFGLAQKGLQTVCLTKVFPTRSHTVAAQGGISAAL
GNMGEDDWRYHFYDTIKGSDWLGDQDAIEYMCREAIPAIIELEHYGVPFSRTEEGKIYQR
PFGGMTTKYGEGPSAQRTCAAADRTGHAMLHTLYQQSLAHNARFMIEYFALDLIFDEEGV
CRGVLALDMAEGSLHLFRAHGVVLATGGYGRAYFSATSAHTCTGDGGGLVMRAGLPVQDM
EFVQFHPTGIYGAGCLITEGVRGEGGILRNSNGERFMERYAPHYKDLASRDVVSRSMTVE
IREGRGVGEHKDHILLDLTHLGPEVINEKLPGIAESAHIFAGVDVTKQPIPVLPTVHYNM
GGIPTNFYGEVVRKQGDDPDAVVPGLYAIGEAACVSVHGANRLGSNSLLDLVVFGRAVAN
RCAETVKPNQPHKTLPSDACDKALGLLDKLRYANSSTPTSVIRDNMQRTMQSDAAVFRTS
KTLKEGVDKMAEIFATFEDVKVSDRSLVWNSDLIETYELNNLLLNAVATINSAEQRKESR
GAHSHEDFPDRDDVNWQKHTLVTVDDKGKCEFEYRPVHMYTLSKDVDVVPPKPRVY
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttacaaaattacagaacacaagtacgacatggtcgtggtgggtgccggcggc
gccggcctgcgtgccacgttcggcttggcccagaaaggcctgcagacggtgtgcctgacc
aaggtcttcccgacccggtcgcacaccgtggcggcgcagggcggcatttccgccgcgctc
ggcaacatgggcgaagacgattggcgttatcacttctacgacaccatcaagggctcggat
tggctgggcgaccaggacgcgatcgagtacatgtgtcgcgaagcgattccggccatcatc
gagctggaacactacggcgtgccgttctcgcgtaccgaagagggcaagatctatcagcgc
ccgttcggtggcatgaccaccaagtacggcgaaggcccgtcggcgcagcgcacctgcgcg
gcagccgaccgtaccggccacgccatgctgcatacgctgtatcagcagtcgctggcgcat
aacgcgcgcttcatgatcgagtacttcgcgctggacctgatcttcgacgaagaaggtgtc
tgccgtggcgtgcttgcgctggacatggctgaaggctcgttgcatctgttccgcgcccac
ggcgtagtgctggccaccggcggctacggccgcgcctacttcagtgctacctccgctcat
acatgtaccggtgacggcggcggcctggtgatgcgtgccggcttgccggtgcaggacatg
gagttcgtgcagttccacccgaccggtatctacggtgcgggctgcctgatcaccgaaggc
gtgcgcggcgaaggtggcattctgcgcaacagcaacggcgagcgcttcatggagcgctat
gcaccgcattacaaggatctggcctcgcgcgacgttgtctcgcgttcgatgaccgtggaa
attcgcgaaggccgcggcgtcggcgagcacaaggatcacatcctgctcgacctgacccac
ctcggcccggaagtcatcaatgaaaagcttcccggcatcgccgaaagcgcccacatcttt
gccggtgtggacgtgaccaagcagccgattccggtactgccgaccgtgcactacaacatg
ggcggcattccgaccaatttctacggcgaagtcgtgcgcaagcagggcgacgacccggat
gcggttgttcccggtctgtacgcgatcggcgaagccgcctgcgtgtcggtgcatggtgcc
aaccgtctgggttccaactcgttgctggatctggtggtgttcggccgtgcggtggcaaac
cgctgcgccgaaacggtcaagccgaaccagccgcacaagacgttgccgtcggatgcctgc
gacaaggcgctcggtctgctggacaagttacgctacgccaacagctctacgccgacctcg
gtgattcgcgacaacatgcagcgcaccatgcagtccgacgctgcggtgttccgtaccagc
aagacgctcaaggaaggcgtggacaagatggccgagatcttcgctactttcgaagacgtc
aaggtgtccgaccgctcgctggtctggaactcggatctgatcgagacgtacgaattgaac
aacctgctgctcaacgcggtggcgacgatcaattcggccgagcagcgaaaggaaagccgt
ggcgcgcattcgcacgaagacttcccggaccgcgacgacgtcaattggcagaaacacacg
ctagtcaccgtcgacgacaagggcaagtgcgagttcgaatatcgtccggtgcacatgtac
acgctgagcaaggacgtggacgtcgtcccgccgaagccgcgcgtttactga

DBGET integrated database retrieval system