KEGG   Xanthomonas vesicatoria: BJD12_13135Help
Entry
BJD12_13135       CDS       T04741                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00010  Glycolysis / Gluconeogenesis
xve00620  Pyruvate metabolism
xve01100  Metabolic pathways
xve01110  Biosynthesis of secondary metabolites
xve01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BJD12_13135
   00620 Pyruvate metabolism
    BJD12_13135
Enzymes [BR:xve01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     BJD12_13135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: APP76016
UniProt: F0BKU6
LinkDB All DBs
Position
3040658..3042187
Genome map
AA seq 509 aa AA seqDB search
MNAQSATKPLNTDPQSIFKSRYDNFIGGKWMAPASGQYFDNTTPISGKVFTSIARSTAPD
IEAALDAAHAAKEAWGKTSTTERSNVLLKIADRIEQNLELLAYAETWDNGKPVRETLNAD
VPLCVDHFRYFAGAIRAQEGGISEIDSDTIAYHFHEPLGVVGQIIPWNFPLLMACWKLAP
ALAAGNCVVMKPAEQTPASILVLMEVIGDLLPPGVLNVVNGFGLEAGKPLASNPRIAKIA
FTGETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVMAEDDDFLDKAVEGLVLFAFNQ
GEVCTCPSRALIQESIYDKFMEKALKRVAAIKQGNPLDPNTMVGAQASSEQLEKILSYID
IGRQEGAEVLIGGERNMLDGELGEGFYVKPTVFKGHNKMRVFQEEIFGPVVSVTTFKDEA
EALAIANDTLYGLGAGVWSRDASRLYRMGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIG
RENHKMMLDHYQQTKNLLVSYSPKALGFF
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcaatctgcaaccaagccactcaacaccgacccgcagtccatcttcaaatcg
cgctacgacaacttcatcggcggcaagtggatggcgccggcaagcggccagtacttcgac
aacactacgccgatcagcgggaaggtctttacttcgattgcgcgttccactgcgccggac
atcgaagccgcactcgacgctgcacatgcggcaaaagaagcctggggcaagacctccacc
actgagcgctccaacgtattgctcaagatcgccgaccgcatcgagcagaatcttgaattg
ctggcgtatgccgaaacctgggacaacggcaaaccggtgcgcgaaacgctcaatgccgac
gtgccgctgtgcgtggaccacttccgttattttgccggcgcgatccgtgcacaggaaggt
ggtatttccgagatcgacagcgacaccatcgcctaccatttccacgaaccgctgggcgta
gtggggcagatcattccgtggaatttcccactgctgatggcgtgctggaaactagcaccg
gcgctggctgccggcaactgcgtggtgatgaagccggccgagcagacgcctgcgtcgatt
ctggtgttgatggaagtcatcggcgatctgctgccgcccggcgtgttgaacgtggtcaac
ggcttcggcctggaggcgggcaagccgctggccagcaacccgcgcattgccaagatcgcc
ttcaccggcgaaaccaccaccggccgcttgatcatgcaatacgccagccagaacctgatt
ccggtgacgctggagctgggtggtaagtcgccgaacatcttctttgccgatgtcatggcc
gaagacgatgattttctggacaaggcggtggaaggccttgtgctattcgccttcaatcag
ggcgaggtgtgcacctgcccgtcgcgtgcgctgatccaggaatcgatctacgacaagttc
atggaaaaggcgctcaagcgcgtggccgcaatcaagcagggaaatccgctcgatcccaac
accatggtcggtgcgcaggcgtccagcgagcagttggaaaagatcttgtcgtatatcgat
atcggcaggcaggaaggtgctgaagtattgattggtggcgagcgcaacatgctcgatggc
gagctcggcgagggcttctacgtcaagccgacggtgttcaagggccacaacaagatgcgc
gtgttccaggaagagatcttcggcccggtggtgtcggtgaccaccttcaaggacgaggcc
gaggccttggcgattgccaacgacacgctctacggactgggtgccggcgtgtggagccgc
gacgcatcgcgcctgtatcgaatgggccgtgccatccaggccgggcgcgtgtggaccaac
tgctatcacgcctacccggcacacgccgcgttcggtggctacaagcagtcgggcatcggc
cgcgaaaaccacaagatgatgctcgaccattaccaacagaccaagaatctgctggtgagc
tattcgccgaaggcgctgggatttttttga

DBGET integrated database retrieval system