KEGG   Xanthomonas vesicatoria: BJD12_16855Help
Entry
BJD12_16855       CDS       T04741                                 

Definition
(GenBank) cell division protein
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00550  Peptidoglycan biosynthesis
xve01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJD12_16855
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BJD12_16855
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xve01011]
    BJD12_16855
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xve03036]
    BJD12_16855
Enzymes [BR:xve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     BJD12_16855
Peptidoglycan biosynthesis and degradation proteins [BR:xve01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   BJD12_16855
Chromosome and associated proteins [BR:xve03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    BJD12_16855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: APP76617
UniProt: F0BCL5
LinkDB All DBs
Position
3892760..3894622
Genome map
AA seq 620 aa AA seqDB search
MKTGRNRARSNFNLRGRLTLVGIALGLCSVTLIGRAAFVQLVNRDFYQRQGEARYLRELP
IATSRGMITDRNGEPLAVSTPVESIWVNPQELLRNPDRIAELAKALGQPLDELNARLAQK
AGKEFMYLQRRINPDKAHAIVALKIPGVFSQREFRRFYPQGEAMAHVLGFTNIDDRGQEG
LELAFDEWLRGKPGSKKVVRDARGAIVESVDLVRPAQPGKDLTLSIDRRIQFLAYKELRN
ALVENNAAGGSMVVMDVATGEVLAMVNLPTYNPNSVTGINPSARRNRAVTDLVEPGSTMK
PLTVATALTAGVVTKDTIIDTNPGYMSVGRFTIRDVPRNNGVLNVTGVITRSSNIGAAKI
AAKVPDQTFYQSIRNFGYGSAPHSGFPGESSGVVLQPARWSGPSKTTMSYGYGLSVTPLQ
IAQAYATLGNGGKLTPPTFVRGQHNETRQVITPEVAREVIDMMETVVTQGGAKGAAILGY
HVAGKTGTARKNGANGYERGHYNALFAGLVPATRPRFATVIVINDPQGKVYYGGLVSAPV
FHKVMEGALRLMDVPPDDIQSWLAAQAAGKTGQPIVKPQPADLDPALVPDPVDEVSAGIP
TAIAPPPAPAQPAPLQESRQ
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccggccgcaatcgcgcccgtagcaacttcaacctgcgcggccgcctgacgttg
gtcggcatcgcgctgggcctgtgctcggtgacgttgatcggccgcgcggcgttcgtgcag
ctggtcaaccgcgatttctaccagcgccagggcgaagcccgttacttgcgcgaactgccg
attgccacctcgcgcggcatgatcaccgaccgtaacggcgagccgttggcggtgtccacg
ccggtggaatcgatctgggtcaacccgcaggaactgttgcgcaatcccgaccgcatcgcc
gagttggccaaggcgctcggccagccgctggacgagttgaacgccaggctggcgcagaag
gccggcaaggaattcatgtacctgcagcgccggatcaacccggacaaggcgcatgcgatt
gtggcgttgaagattccgggcgtgttctcgcagcgcgagttccgccgcttctatccacag
ggcgaagcaatggcccacgtgttgggctttaccaacatcgacgaccgcggccaggaaggg
ctggagctggcgttcgacgaatggttgcgtggcaagcccggctccaagaaggtggtgcgc
gatgcgcgcggcgccatcgtggagagcgtggacctggtgcgtccggcgcagccgggcaag
gacctgacgctgagcatcgaccgtcgcatccagttcttggcctataaggaactgcgcaac
gcgctggtcgaaaacaatgcggccggcgggtcgatggtggtgatggacgtggccaccggc
gaagtgctggcgatggtcaacctgcccacttacaaccccaactcggtcaccggcatcaac
ccgtcggcgcgacgcaaccgcgcggtcaccgatctggtggagccgggttcgacgatgaag
ccgctgaccgtggccaccgcgctgaccgccggcgtggtgaccaaggacaccatcatcgat
accaaccccggctatatgtcggtggggcgcttcaccatccgcgatgtgccgcgcaacaac
ggcgtgctcaacgtcaccggcgtgatcacccgcagctccaacatcggtgcggccaagatc
gcggccaaggtgccggaccagaccttctaccagtcgatccgcaacttcggttacggcagt
gcgccgcatagcgggttcccgggcgagtcgtcaggcgtggtgctgcagccagcgcgctgg
agcggcccgtccaagaccacgatgtcctacggttacggcctgtcggtcacgccgctgcaa
attgcgcaggcgtacgccacgctgggcaacggcggcaagctgacgccgccgaccttcgtg
cgtggtcagcacaacgagacccgtcaggtgatcacccccgaggtggcgcgtgaagtcatc
gacatgatggagaccgtggtcacccagggcggcgccaagggcgcggcgatcctgggctat
cacgtggccggcaagaccggcaccgcccgcaagaacggcgccaacggctacgagcgtggg
cattacaacgcgctgttcgccggcctggtgccggccacccgtccgcgctttgccaccgtc
atcgtcatcaacgatccgcagggcaaggtgtattacggcggcctggtgtcagcaccggtg
ttccacaaggtgatggaaggcgcgctgcggttgatggacgtgccgccggacgacatccag
tcgtggctggccgcacaggccgccggcaagaccgggcaaccgatcgtcaagccgcaaccg
gccgatctggatccggcgctggtgccggacccggtggacgaagtgtcggccggcatcccg
accgccatcgcaccgccgccagcgcctgcgcagcctgcgccgctgcaggagagccgccag
tga

DBGET integrated database retrieval system