KEGG   Xanthomonas vesicatoria: BJD12_16890Help
Entry
BJD12_16890       CDS       T04741                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00473  D-Alanine metabolism
xve00550  Peptidoglycan biosynthesis
xve01100  Metabolic pathways
xve01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BJD12_16890
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BJD12_16890
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    BJD12_16890
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:xve01011]
    BJD12_16890
Enzymes [BR:xve01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     BJD12_16890
Peptidoglycan biosynthesis and degradation proteins [BR:xve01011]
 Precursor biosynthesis
  Amino acid ligase
   BJD12_16890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: APP76624
UniProt: F0BCK8
LinkDB All DBs
Position
3902739..3903695
Genome map
AA seq 318 aa AA seqDB search
MSAVIANARTSDPAAFGRVAVLLGGTSSEREVSLNSGSNVLDALRARGVDAQPVDGIPAL
AQALVAGQFDRVFNVLHGHNGGGEDGIVQGLMEAFGIPYTGSNVLGSALSMDKIRTKQVW
LSLGLPTPRYARLAAGVSADEIHAAARQIGLPVIVKPANEGSSVGISRVFDQAQLEEAVL
LAARYDGALLMEQLIEGDELTVAILGETALPSIRIVPKGQWYDYNAKYLADDTQYLCPGL
DGDAEAQIGQLALDAFRAAGARDWGRVDVMRDRSSGQLYLLEVNTAPGMTSHSLVPKAAR
QLGLDFEELVWRVLEQTL
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggtgatcgccaacgcacgcaccagtgatccggcagccttcggacgtgtcgcc
gtgctgctcggcggcacctcctccgagcgcgaagtctcgttgaattccggcagcaacgtg
ctcgacgcactgcgcgcgcgcggtgtcgatgcgcagccggtcgatggcattcctgcgttg
gcgcaggcgctggtcgccggccaatttgatcgcgtgttcaacgtgctgcacggccataac
ggcggcggcgaagacggcatcgtgcagggcttgatggaagcctttggcattccgtacacc
ggttccaacgtgctcggctcggcgctgagcatggacaagatccgcaccaagcaggtgtgg
ttgtcgctgggcctgccgacgccgcgttatgcgcgtctggccgccggcgtcagcgccgat
gagatccatgctgccgcacgccagatcggcttgccggtaatcgtcaagccggccaacgaa
ggctcgagcgtcggtatcagccgcgtgttcgatcaggcgcagcttgaagaagccgtgctg
ctggccgcgcgctacgacggcgcgctgttgatggagcaattgatcgaaggcgacgaactc
accgtggcgattctgggcgagaccgcgctgccgtcgattcgcatcgtgcccaagggccag
tggtacgactacaacgccaagtacctggccgacgacactcaatatctgtgtccggggctg
gatggcgatgccgaagcgcagatcggccagctcgcgctggatgcgttccgcgccgccggt
gcacgcgactggggccgcgttgacgtcatgcgcgaccgcagcagcggccaactgtatctg
ctcgaagtgaacaccgccccgggcatgaccagccactcgctggtgcccaaggccgcccgt
cagctcggcctcgatttcgaagagctggtctggcgcgtactggagcagacgctgtga

DBGET integrated database retrieval system