KEGG   Xanthomonas vesicatoria: BJD12_16995Help
Entry
BJD12_16995       CDS       T04741                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00500  Starch and sucrose metabolism
xve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BJD12_16995
Enzymes [BR:xve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BJD12_16995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: APP76640
UniProt: F0BCI7
LinkDB All DBs
Position
complement(3927050..3928477)
Genome map
AA seq 475 aa AA seqDB search
MRSTPAHAPPSLKQRCGRLLLTALALLLTTANVQADVILHAFNWPYATVEARAKQIADAG
YRKVLVAPAYRSQGSAWWARYQPQDLRVIDGPLGDTAAFARMVQALANNGVETYADVVLN
HMANEAATRSDLNYPGSAVLSQYAANPGRYDSLRLFGTLQSNFLSASDFGPAQCIANYND
AFQVRNYRICGGGSDPGLPDLVGNDWVVQQQRAYLQALKGLGVSGFRMDAAKHMTFDHLN
RVFDAGIRSGVYVFGEVITGGGTGNGDYDQFLAPYLQSTPHAAYDFPLFNAVRNAFAVGA
SMQQLVDPASSGQALPGNRAVTFAITHDIPNNAGFRYAILDPVDETLAYAYLIGRNGGVP
MVYTDNNESGDNRWVNAYQRDDLRRMIGFHNGVQGTDMQVLSSSSCHILFRRGSLGIVGI
NKCGNPVTTTVGMNNSVLYWNADYVDALGSGTVVRITSGSYTFTLPARGSRMWRR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcgtagcacgcctgctcatgctccaccctcgctcaaacaacgctgcggccgcctgctg
ctgacagcgctggccttgctgctgaccacggccaatgtccaggccgatgtcatcctgcat
gccttcaactggccctatgccaccgtggaagcacgcgccaagcagatcgccgatgccggt
tatcgcaaggtgctggtggccccggcgtatcgctcgcaaggcagcgcgtggtgggcacgc
tatcaaccgcaggatctgcgtgtgatcgatgggccgctgggcgacaccgccgcgttcgcg
cgcatggtgcaggcgctggccaacaacggtgtggaaacctacgccgatgtggtgctcaac
cacatggccaacgaagcggcgacacgctcggacctcaactaccccggcagcgcggtgttg
tcgcagtacgccgccaaccctggccgttacgattcgctacgcctgttcggcaccttgcag
tcgaactttctgagcgccagcgacttcggccctgcgcaatgcatcgccaactacaacgac
gccttccaggtgcgcaattaccgtatctgcggcggtggcagcgacccgggcttgccggat
ctggtcggtaacgactgggtggtgcaacagcagcgcgcctacctgcaagcactcaagggc
ctgggcgtcagcggtttccgcatggatgccgccaagcacatgacgttcgatcacctgaat
cgcgtgttcgatgccggcatccgctccggcgtgtacgtgttcggcgaagtgatcaccggc
ggcggcaccggcaacggcgattacgaccagttccttgctccgtacctgcagtccacgccg
catgcggcctacgacttcccgttgttcaacgcagtgcgcaatgcatttgccgtcggtgcc
agcatgcagcagctggtggatccggccagcagcgggcaagcattgcctggcaatcgcgcg
gtgaccttcgccatcacgcacgacatccccaacaacgccggcttccgttacgccattctc
gacccggtcgacgaaaccctggcctacgcgtacctgatcggccgcaacggcggcgtgccg
atggtctacaccgacaacaacgagagcggcgacaaccgctgggtcaacgcctaccagcgc
gacgacctgcgccgcatgatcggcttccacaacggcgtacagggcaccgacatgcaggtg
ctgtcgtccagttcctgccacatcctgttccgtcgcggcagcctgggcatcgtgggcatc
aacaaatgcggcaatccggtcaccaccaccgtcggcatgaacaacagcgtgttgtactgg
aatgcagactacgtggacgcgctgggctcgggcaccgtggtgcgcatcaccagcggctcc
tacacgttcaccctgccggcacgcggcagccggatgtggcggcgctga

DBGET integrated database retrieval system