KEGG   Xanthomonas vesicatoria: BJD12_17040Help
Entry
BJD12_17040       CDS       T04741                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00620  Pyruvate metabolism
xve00680  Methane metabolism
xve01100  Metabolic pathways
xve01120  Microbial metabolism in diverse environments
xve01200  Carbon metabolism
Module
xve_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BJD12_17040
  09102 Energy metabolism
   00680 Methane metabolism
    BJD12_17040
Enzymes [BR:xve01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     BJD12_17040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: APP76648
UniProt: F0BCH6
LinkDB All DBs
Position
3938990..3941704
Genome map
AA seq 904 aa AA seqDB search
MNEYRSSLVFATPDLPLRDDVRRLGALVGDLLAEQVSAEFLDEIERVRTTAIARRESDAP
PSTLSEQLAGREPRDAESLVRAFSTYFQVVNIAERVHRIRRRREYQRSGIDTPQPDGLHD
ALRRLKAQGVSLDELSEWLPRIDVEPVFTAHPTEAVRRALLEKEQLMVASLVDNLDGMRT
PNERASDAARFRMALTASWQTADSSPVRPTVDDEREHVGFYLIQVLYRVIPVMYETLEHA
IEETYGSVPSLPRLLRFGTWVGGDMDGNPNVDATTIAGTLDAQRRAVLDRYQKELWQLAS
LLSQSTTLVAVSPALNAQLERYRALLPDAAARSRPRHGDMPYRLLNDLMRARLQATLDDA
DGAYTAPSELEQDLQLILDSLQANKGLHAGWFAVRRLLWRVRSFGFHLARLDVRQESSVH
ARAVADALGQADWDEQDAKQRAALLGPYASGEQALPRVEDEGNARLDAVFAALADARMRH
GADALGSYIISMAHNRADVLTVLALARRGGLVDDAGAVPLDIVPLFETVDDLRGGTGTVQ
DLLADPVYRQHLAARGDTQMVMLGYSDSGKDGGIAASRWGLQRAQVELLEAAAELGVRLT
FFHGRGGSIARGGGKTSRALDAAPRGSVDGRLRVTEQGEVIHRKYGIRALALRSLEQMTG
AVLLSSLRPRAPEPREDNWRPVMDLVAERSTVAYRAFVGAPDFMQYFRLATPIDVIERMT
LGSRPSRRLGQDAALSNLRAIPWVFAWSQARAVIPGWYGVGSGLQAAVDAGHEDSLREMA
QDWPFFRTFLDDIAMVLSKGDLNIAELFSRLSGDLHMRFFPQIRDELALTKRWVKALLQQ
QSLLQHDPRLALSIRLRNPYIDPISVLQVDLLQRWRATDGEDEDLLRALVACVNGVSQGV
QNTG
NT seq 2715 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtaccgcagcagtcttgtgttcgctacccccgatcttcccttgcgcgacgat
gtgcgtcgcctcggtgcactggtcggcgatctgctcgccgaacaggtgtctgcggaattc
cttgatgaaatagaacgcgtccgcaccactgccatcgcgcggcgcgaaagcgatgcgccg
ccctccacgctgagcgagcaactggccggccgtgagccgcgcgatgccgagtcgctggtg
cgtgcgttcagcacgtatttccaggtggtcaacatcgccgagcgcgtgcatcgcatccgc
cgccgccgcgagtaccagcgcagcggtatcgatacgccgcagcccgacggcctacacgat
gccttgcgccggctcaaggcgcagggcgtgagcctggatgaactgagcgagtggttgccg
cgcatcgacgtggagccggtgttcaccgcgcaccccaccgaagcggtgcgccgcgcgttg
ctggaaaaagaacagctgatggtcgccagcctggtcgataacctcgacggcatgcgcacg
cccaacgagcgcgccagcgatgcggcgcgcttccgcatggcgctgaccgcctcctggcag
accgccgactcctcgccggtgcgtcctaccgtggacgacgaacgcgagcacgttgggttc
tatctcatccaggtgctctatcgcgtcatcccggtgatgtacgaaaccctcgaacacgcc
atcgaagaaacctacggcagcgtgccgtccctgccgcgcctgctgcgcttcggcacctgg
gtgggcggggacatggacggcaatcccaacgtggatgccaccaccattgccggcacgctg
gatgcgcagcgccgcgccgtgctggaccgctaccagaaagaactctggcagctggccagc
ctgctcagccagtccaccacgctggtggcggtgagcccagcgttgaacgcgcaactggag
cgttatcgcgccttgctgccggacgctgccgcgcgctcgcgcccgcgccacggcgacatg
ccgtaccggttgctcaacgatctgatgcgcgcacgcctgcaggccacgttggacgatgcc
gatggcgcctacaccgcgccgtcggagcttgagcaggatctgcaattgatcctggacagc
ctgcaggccaacaagggactgcacgccggctggtttgcggtgcgccggctgttgtggcgc
gtgcgcagcttcgggtttcatctggcgcggctggatgtgcgccaggaatcgagcgtgcat
gcgcgtgcagtggccgatgcactcggccaggcggactgggacgaacaggatgccaagcag
cgcgctgccttgctcggcccgtacgcgtccggcgaacaggcgttgccgcgcgtggaggac
gaaggcaatgcacggctggatgcggtcttcgccgcacttgccgatgcacgcatgcgccat
ggcgccgatgcactgggtagttacatcatctcgatggcgcataaccgcgccgatgtgctc
accgtgcttgccttggcgcggcgtggtggcctggtcgacgacgctggtgcggtgccgctg
gatatcgtgccgctgttcgaaacggtggacgatttacgcggcggcaccggcaccgtgcag
gacctgctggccgacccggtgtatcgccaacacctggccgcgcgtggcgatacgcagatg
gtgatgctggggtattcggacagcggcaaggacggcggcatcgcggcctcgcgctggggc
ctgcagcgcgcccaggtggaactgctggaagcggccgccgagctgggcgtgcggctgacc
tttttccatggccgcggcggttcgatcgcacgcggtggcggcaagaccagccgtgcgctg
gatgctgcgccgcgcggcagcgtcgacggtcgcctgcgcgtcaccgagcagggcgaggtg
atccatcgcaagtacggcattcgcgcgttggcattgcgctcgctggagcagatgaccggt
gcggtgctgttgtccagcctgcgtccgcgcgcgcccgagccgcgcgaggacaactggcgg
ccggtgatggatctggttgccgaacgcagcaccgtggcctatcgcgccttcgtcggtgcg
ccggatttcatgcagtacttccgcctcgcgacgccgatcgatgtgatcgaacgcatgacg
ctgggctcgcgcccgtcgcgtcggctgggccaggatgcggcgctgtcgaatctgcgcgcg
atcccctgggtatttgcgtggagccaggcgcgtgcggtgattccggggtggtacggcgtg
ggcagcggcttgcaggcggcggtggatgccgggcatgaagacagcctgcgcgagatggcg
caggactggccgttcttccgcaccttcctggacgacatcgccatggtgctgtccaagggc
gaccttaatatcgccgagctgttttcgcggctgtccggtgacctgcatatgcggtttttc
ccgcagattcgcgacgaactggcgctgaccaagcgctgggtcaaggcgctgctgcaacag
caatcgttgctgcagcacgacccgcggcttgcgttgtcgatccgcctgcgaaacccctat
atcgacccgatcagcgtgttgcaggtcgacctgctgcagcgttggcgcgccaccgacggc
gaagacgaagatctgctgcgtgcgctggtcgcctgcgtcaacggcgtctcgcaaggggtg
cagaacaccggctga

DBGET integrated database retrieval system