KEGG   Xanthomonas vesicatoria: BJD12_17445Help
Entry
BJD12_17445       CDS       T04741                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
xve  Xanthomonas vesicatoria
Brite
KEGG Orthology (KO) [BR:xve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BJD12_17445
Enzymes [BR:xve01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BJD12_17445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored FAD_binding_2 HI0933_like Glutaredoxin DAO AlaDh_PNT_C FAD_binding_3 NAD_binding_7 Thi4 FMO-like K_oxygenase Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: APP76713
UniProt: F0B8V4
LinkDB All DBs
Position
complement(4025056..4026648)
Genome map
AA seq 530 aa AA seqDB search
MLDANLKTQLTAYLERVTRPIQINASIDDSPAAREMLDLLEDLVLLSDKISLDVHRDDNQ
RKPSFALTTPGQDISLRFAGLPMGHEFTSLVLALLQVGGHPSKATAELIEQVQHLDGDYQ
FETYFSLSCQNCPDVVQALNLAAVLNPRIKHVAIDGALFQDEVETRQIMSVPTVYLNGEL
FDQGRMTLEQIVAKLDTNAAKRDAAKIAAKDAFDVLVVGGGPAGSAAAVYAARKGIRTGV
AAERFGGQVLDTMSIENFISVPETEGPKMAAALEQHVRQYDVDIMNLQRAEQLVPAGADG
LIEIKLANGASLKSKTVILSTGARWRQMNVPGEDQYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLMEFDDKLRADEVLQRKLRSLHNVRIITSAQTTEVLGDG
QKVTGLVYTDRTGGDSQHVELEGVFVQIGLLPNTEFLRGTVELSPRGEIIVDDRGQTSVP
GVFAAGDATTVPYKQIVIAMGEGSKAALSAFDYLIRSSAPVSPENVAQAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaacctcaagacccagctgaccgcctacctggaacgggtcacgcggccg
atccagatcaatgcgtccatcgacgacagcccggctgcgcgcgagatgctcgacctgctg
gaagacctggtgctgctctcggacaagatcagcctggacgtccaccgcgacgacaaccag
cgcaagccgtcgttcgcgctgaccacgccgggccaggacatctcgctgcgctttgccggc
ctgccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggtgggcggccac
ccgtccaaggccactgccgagctgatcgagcaggtgcagcacctggacggcgattaccag
ttcgaaacctatttctcgctgtcgtgccagaactgcccggacgtggtgcaggcgctgaac
ctggccgccgtgctcaatccccgcatcaagcatgtcgccatcgatggcgcgctgttccag
gatgaggtcgaaacccgccagatcatgtcggtgccgacggtgtacttgaacggcgaactg
ttcgaccagggccgcatgacgctggagcagatcgtcgccaagctcgataccaatgccgcc
aagcgcgatgccgcaaaaatcgccgccaaggatgccttcgacgtgctggtggtgggcggt
ggcccggccggctcggcagcggcagtgtatgccgcacgcaagggcatccgcaccggcgtg
gccgccgaacgcttcggcgggcaggtgctggacaccatgtcgatcgaaaacttcatctcc
gtgccggaaaccgaaggcccgaagatggccgccgcgctggagcagcacgtgcgccagtac
gacgtggacatcatgaacctgcagcgtgccgagcaattggtgccggccggtgccgatggc
ctgatcgaaatcaagctggccaatggcgcctcgctcaagagcaagaccgtgatcctgtcc
accggtgcgcgctggaggcagatgaacgtgccgggcgaggaccagtacaagaacaagggc
gtggcctattgcccgcattgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaactccggtgtggaagcggcgatcgatctggccggcatcgtggcgcatgtc
acgctgatggaattcgacgacaagctgcgcgccgacgaggtgctgcaacgcaagctgcgc
agcctgcacaacgtgcgcatcatcaccagtgcgcagaccaccgaagtgctgggcgacggg
cagaaggtcaccggactggtctacaccgaccgcaccggcggcgacagccagcatgtggaa
ctggaaggcgtgttcgtgcagatcggcctgctgcccaacaccgagttcctgcgtggcacg
gtggagctgtctccgcgcggcgagatcatcgtcgatgaccgtggccagaccagcgtgccg
ggcgtgttcgccgccggcgacgccaccacggtgccgtacaagcagatcgtgatcgcgatg
ggcgaaggttccaaggccgccctgagcgcatttgattacctgatccgctccagcgccccg
gtcagccccgagaacgtcgcgcaggccgcataa

DBGET integrated database retrieval system