KEGG   Xanthomonas vesicatoria: BJD12_21370Help
Entry
BJD12_21370       CDS       T04741                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
xve  Xanthomonas vesicatoria
Pathway
xve00380  Tryptophan metabolism
xve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xve00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    BJD12_21370
Enzymes [BR:xve01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     BJD12_21370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: APP77349
UniProt: F0BIZ5
LinkDB All DBs
Position
complement(4889346..4890620)
Genome map
AA seq 424 aa AA seqDB search
MSTEPLSRSHAAALDAADPLRSLRDAFVFPQHEGRDQTYFVGNSLGLQPRRARAMVSEVL
DHWGALAVEGHFTGPTQWLTYHQLVRDGLARVVGAQPGEVVAMNTLSVNLHLMMASFYRA
TPERGAILIEAGAFPSDRHAVESQLRLHGLDPATQLIEVEADAPDGTLSMAAIADAIATH
GARLALVLWPGIQYRTGQAFDLGEIARLARAQGAAVGFDLAHAVGNIPLTLHDDGVDFAV
WCHYKYLNAGPGAVGGCFVHERHANSDLPRMAGWWGHEQQTRFRMEPQFVPTPGAEGWQL
SNPPVLALAPLRASLELFDQAGMPALRGKSEHLTGHLEQLIHARVPQVLQIVTPAEPTQR
GCQLSLRVAGGRAQGRALFEHLHAAGVLGDWREPDVIRIAPVPLYNRFSDLHTFVEQVET
WAAS
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgaaccgttgtcccgttcccacgccgcggcgctggatgccgccgacccgctg
cgcagcctgcgcgatgcctttgtgttcccgcagcacgagggccgggatcagacctatttc
gtcggcaattcgctgggcctgcaaccgcgtcgggcccgcgcgatggtgagcgaagtgctc
gatcactggggcgcgcttgcagtggaaggccacttcaccggccccacgcaatggctgacc
tatcaccagttggtgcgcgacggcctggcacgcgtggtcggcgcgcaaccgggcgaagtg
gtcgcgatgaataccctcagcgtcaatctgcatctgatgatggcgagcttttatcgcgcc
acgcccgaacgcggcgcgatcctgatcgaagccggtgcgttcccgtccgaccgccacgcg
gtggaatcgcagctgcgcctgcacgggctggatccggccacgcagttgatcgaagtggag
gccgatgcacccgatggcacgttgtcgatggcggccattgccgatgccatcgccacgcac
ggtgcgcgcctggccttggtactgtggcccggtatccagtaccgcaccggccaggccttc
gacctgggcgaaatcgcgcgactggcgcgtgcgcaaggtgcggcagtgggcttcgatctg
gcgcatgcggtgggcaatatcccgctgaccctgcacgacgacggcgtcgatttcgcagtg
tggtgccactacaaatatctcaatgccgggccgggcgcggtgggtgggtgcttcgtgcac
gaacgccatgccaatagcgacctgccgcgcatggccggctggtggggacacgagcagcag
acccgcttccgcatggagccacagttcgtgcccacgcccggcgcggaaggctggcagctg
agcaatccgccggtgctggcgttggcgccgctgcgtgcatcgctggagctgttcgaccag
gccggcatgcccgcgctgcgcggcaagtccgaacacctcaccggacatctggagcagctg
atccacgcccgggtgccgcaggtgctgcagatcgtcaccccggccgaaccgacgcagcgc
ggctgccagctgtcgttgcgggtggccggcggacgcgcgcaggggcgcgcgttgttcgag
catctgcatgcggctggcgtgcttggcgactggcgcgaaccggacgtgatccgcatcgca
ccggtgccgctgtacaaccgtttcagcgacctgcacacctttgtggaacaggtggaaacc
tgggccgccagctga

DBGET integrated database retrieval system