KEGG   Xylanimicrobium sp. FW10M-9: ET471_00425Help
Entry
ET471_00425       CDS       T05815                                 

Gene name
gatB
Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00970  Aminoacyl-tRNA biosynthesis
xya01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xya00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ET471_00425 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xya03029]
    ET471_00425 (gatB)
Enzymes [BR:xya01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     ET471_00425 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     ET471_00425 (gatB)
Mitochondrial biogenesis [BR:xya03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    ET471_00425 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: QAY68699
UniProt: A0A4P6F3E5
LinkDB All DBs
Position
complement(80921..82417)
Genome map
AA seq 498 aa AA seqDB search
MTELVDYADAVKRYDPVLGIEVHVELGTRTKMFCAAEVSFGAEPNTQTTPVSLGLPGALP
VVNGKAVEYAIRIGLALNCQIAETCRFARKNYFYPDVPKNFQTSQYDEPIAYDGWIDVEL
EDGTVFRVEIERAHMEEDAGKNTHVGGATGRIHGAEYSLVDYNRAGIPLVEIVTKPIEGV
GDRAPEVARAYVQTLRDIFRALDVSEARMERGNVRADVNVSLRPTPQDKLGTRTETKNVN
SFRSVERAVRYEISRQAGLLDEGIAIIQETRHFHEDTGTTSSGRVKSDAEDYRYFPEPDL
VPVAPSRDWVEEIRSSLPELPAARRKRLLAEWGFADAEMRDVVNAGALDLIEATTAAGTS
PAAARKWWMGELARQAKQAEVSLDEVAITPAQIAQLQSLVDAGRINDKLARQVLEGVLAG
EGDPEAVVVARGLEVVSDDGALLEAVDAALAAQPDVVEKVRGGNLGPVGAIIGAVMKATR
GQADAQRVRELVLERIGV
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtgactgaactggtcgactacgccgacgccgtcaagcgctacgacccggtgctcggcatc
gaggtccacgtcgagctcggcacccgcaccaagatgttctgcgccgccgaggtctcgttc
ggcgccgagcccaacacgcagaccaccccggtgagcctgggcctgcccggcgcgctgccg
gtcgtcaacggcaaggccgtcgagtacgccatccgcatcggcctggcgctcaactgccag
atcgccgagacgtgccgcttcgcccggaagaactacttctacccggacgtgccgaagaac
ttccagacctcgcagtacgacgagcccatcgcctacgacggctggatcgacgtcgagctc
gaggacggcaccgtcttccgcgtggagatcgagcgcgcgcacatggaggaggacgccggc
aagaacacccacgtcggcggcgccaccgggcggatccacggcgcggagtactcgctcgtg
gactacaaccgcgcgggcatcccgctcgtggagatcgtcaccaagcccatcgagggcgtg
ggcgaccgcgcccccgaggttgcgcgcgcctacgtgcagacgctgcgcgacatcttccgg
gcactcgacgtgtccgaggcccgcatggagcgcggcaacgtgcgcgccgacgtcaacgtc
tcgctgcgcccgaccccgcaggacaagctcggcacccgcaccgagaccaagaacgtcaac
tcgttccggtcggtcgagcgtgcggtgcgctacgagatctcgcgccaggccgggctcctc
gacgagggcatcgccatcatccaggagacccgtcacttccacgaggacacggggacgacg
tcgtcgggccgcgtgaagtcggacgccgaggactaccgctacttccccgagcccgacctg
gtgccggtggcgccgagccgcgactgggtcgaggagatccggtcctcgctgcccgagctc
cccgcggcacgccgcaagcggctgctcgccgagtggggcttcgcggacgccgagatgcgc
gacgtcgtcaacgccggcgccctggacctcatcgaggccacgacggcggcgggcacgagc
ccggcggcggcgcgcaagtggtggatgggcgagctcgcccggcaggccaagcaggcggag
gtcagcctcgacgaggtcgcgatcacgcctgcccagatcgcccagctccagtcgctcgtc
gacgcgggccggatcaacgacaagctcgcgcgccaggtgctcgagggcgtgctcgccggc
gagggcgacccggaggccgtcgtcgtcgcgcgcggcctggaggtcgtctccgacgacggg
gcgctgctcgaggccgtggacgcggccctggccgcccagcccgacgtcgtcgagaaggtg
cgcgggggcaacctcggcccggtcggggcgatcatcggcgccgtcatgaaggcgaccagg
ggccaggccgacgcccagcgcgtgcgcgagctcgtgctcgagcgcatcggcgtctga

DBGET integrated database retrieval system