KEGG   Xylanimicrobium sp. FW10M-9: ET471_14655Help
Entry
ET471_14655       CDS       T05815                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
xya  Xylanimicrobium sp. FW10M-9
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: QAY71124
LinkDB All DBs
Position
complement(3158667..3159803)
Genome map
AA seq 378 aa AA seqDB search
MALPLTPPILPMLATSVASVPAQPDGGPAWDYEPKWDGFRTIVYRDGDDVRLDSRNAKPM
QRYFPEVVEAVRAALPERCVVDGEIVVARPGAGRARLDFEMLSQRIHPAASRVTMLAETV
PASLVVFDVLALDDEDLSGRPLAERLAALDGLGLTGPQVFATPRTADVAVARAWFEQFEG
AGLDGVVAKALDGTYQPNRRGWLKVKHARTADVVLAGYRLHKASTEETPLLGSLLLGLYD
DGGQLQFVGVAASFPAARRAALVTELAGLVVEPGSPGHAAHPWADWQDPAVADGVAGERR
PGAQSRWSAGKDLSFTPLRVERVLEVGYDHMEGTRFRHTAQLKRWRPDREPASCTYAQLE
EPVGYDLAEILPGAPGTA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggccctgccgctgaccccgccgatcctgcccatgctggccacgtcggtcgcgtccgtc
cccgcccagcccgacggcgggcctgcctgggactacgagcccaagtgggacggcttccgt
acgatcgtctaccgcgacggcgacgacgtgcggctcgactcccgcaacgcgaagccgatg
cagcggtacttccccgaggtggtcgaggccgtcagggccgcgctccccgagcggtgcgtc
gtcgacggggagatcgtcgtcgcccggcccggggcgggccgggcgaggctcgacttcgag
atgctgtcccagcgcatccacccggccgcgtcgcgcgtgacgatgctggccgagacggtg
cccgcgagccttgtcgtcttcgacgtcctcgcgctcgacgacgaggacctcagcggccgc
ccgctcgccgagcggctggccgcgctcgacgggctcggcctcaccggcccgcaggtcttc
gccacgccgcgtaccgccgacgtcgccgtcgcgcgcgcgtggttcgagcagttcgagggc
gccggcctcgacggcgtcgtcgcgaaggcgctcgacggcacctaccagcccaaccggcgt
ggctggctcaaggtcaagcacgcccgcacggccgacgtcgtcctcgccgggtaccggctg
cacaaggcgtccacggaggagacgcccctgctcgggtcgctgctcctggggctgtacgac
gacggcgggcagctccagttcgtcggcgtcgcggcgtcgttccccgccgcgcgccgggcg
gcgctcgtgacggagctcgccggcctcgtcgtcgagcccgggtcgcccggccacgccgcg
cacccctgggccgactggcaggaccccgccgtcgcggacggcgtcgcgggggagcggcgg
cccggggcgcagtcgcgctggagcgcgggcaaggacctgtcgttcacgccgctgcgggtg
gagcgcgtcctggaggtcgggtacgaccacatggagggcacccggttccggcacacggcg
cagctcaagcgctggcgccccgaccgggagccggcgtcgtgcacgtacgcgcagctcgag
gagccggtcggctacgacctggccgagatcctcccgggcgcccccgggaccgcgtga

DBGET integrated database retrieval system