KEGG   Xylanimicrobium sp. FW10M-9: ET471_15760Help
Entry
ET471_15760       CDS       T05815                                 

Gene name
pknB
Definition
(GenBank) Stk1 family PASTA domain-containing Ser/Thr kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
xya  Xylanimicrobium sp. FW10M-9
Brite
KEGG Orthology (KO) [BR:xya00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xya01001]
    ET471_15760 (pknB)
Enzymes [BR:xya01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ET471_15760 (pknB)
Protein kinases [BR:xya01001]
 Serine/threonine kinases: Other
  Bacterial family
   ET471_15760 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like Pkinase_fungal ABC1
Motif
Other DBs
NCBI-ProteinID: QAY71305
LinkDB All DBs
Position
3390808..3392889
Genome map
AA seq 693 aa AA seqDB search
MAQVTTDPLLGRLVDGRYEITSRIARGGMATVYLAVDRRLDREVALKVMHPHLAEGVDGA
AFVSRFRREARAAARLAHPGVVAVYDQGLDGDTSYLTMEYVPGSNLRRELRAEGTLTVGR
TLDVLGEVLGALAAAHRKGLVHRDVKPENVLVTTEGRHVKVADFGLARAVTEVTSTTTGT
VLGTVAYLAPEVIATGACDARTDVYAVGVLAYEMLTGTLPHDGATPIQVAFQHVHDDIPS
PAEREPWLPAQLADLVTRFAAREPGRRPADGGAALDALRAVRASLAPEVLARRAEPPAGF
VPPAPVPDGAAASDSADALDADELDAIPVAAAVGPLAEPVPVTTPPDGISAWFPAEDADH
ATEPLVDQPTTRVTTPATASTAAASPAGTAPPRHRRRWPRVLAWVLGLVVLLGGAGYGAW
WYFEDGPGAWTTVPAGIEDVTLDEATAILTTHGLTSSSTEAYDDTVPAGSVVSADPGEGA
EVRRDGSVALVVSLGVRMVTVPDGLVGSQQSDAEAALAAADLEAGPAHQEWSDTVPVGEV
MDVSHAANASVPHSTVVTLTVSGGPAPATVTQQVGRDRADAQAALEDLGFAVAFTADEAS
ETVPAGRVIRQTPTSGTQAHRLDTVTLTVSSGPPIIDVPNVVGMRTGAATDTLTRAGFEV
DTVKYLGGILDTVRFQDPEGTAPKGSTVKITVW
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
gtggcccaggtgacgaccgaccctctgctcggccgcctcgtcgacgggcggtacgagatc
acgtcgcgtatcgcgcgcggcggcatggcgaccgtgtacctcgccgtcgaccggcggctc
gaccgcgaggtcgcgctcaaggtcatgcacccgcacctggccgagggcgtcgacggcgcc
gcgttcgtctcccgcttccgccgcgaagcacgggccgccgcccggctcgcgcaccccggc
gtcgtcgccgtctacgaccagggcctcgacggcgacaccagctatctcacgatggagtac
gtgcccggcagcaacctgcgccgcgagctgcgcgccgagggcaccctgacggtgggccgg
accctcgacgtgctcggcgaggtgctcggagccctcgccgccgcgcaccgcaagggcctg
gtgcaccgcgacgtgaagccggagaacgtgctcgtcacgaccgagggccggcacgtcaag
gtggccgacttcggcctcgcccgcgcggtcacggaggtcaccagcacgacgacgggcacc
gtcctcgggaccgtcgcctacctggcccccgaggtcatcgcgacgggtgcgtgcgacgcc
cgcaccgacgtctacgccgtcggcgtcctcgcgtacgagatgctcaccggcacgctgccg
cacgacggcgccacgccgatccaggtcgcgttccagcacgtgcacgacgacatcccctcg
cccgccgagcgcgagccgtggctgcccgcgcagctcgcggacctggtgacccggttcgcg
gcccgcgaaccgggccggcgtcccgccgacggcggcgccgcgctcgacgcgctgcgcgcc
gtgcgggcgtcgctcgcgcccgaggtgctcgcacgtcgcgcggagcccccggccgggttc
gtgccgcccgcgcccgtgcccgacggcgcggcggcctccgacagcgccgacgccctcgac
gccgacgagctcgacgcgatcccggtcgccgcggcggtcgggccgctcgcggagcccgtc
ccggtgacgacgccgcctgacggcatctccgcgtggttcccggccgaggacgccgaccac
gccaccgagcccctcgtcgaccagccgacgacgcgggtgaccacgcccgccaccgcgagc
actgccgccgcgagccccgccgggacggccccgccgcgccaccgccggcgctggccgcgt
gtcctcgcctgggtgctcggcctcgtcgtgctcctgggcggcgccggctacggcgcctgg
tggtacttcgaggacggccccggcgcctggaccacggtgcccgccggcatcgaggacgtg
acgctcgacgaggcgaccgcgatcctgacgacgcacggcctgacgtccagcagcacggag
gcgtacgacgacacggtgcccgcgggctcggtggtgtccgcggacccgggcgagggcgcc
gaggtccgcagggacggcagcgtcgcgctcgtcgtgtcgctcggcgtccgcatggtcacg
gtgcccgacgggctcgtcgggtcccagcagtccgacgcggaggccgcgctcgccgcggcc
gatctcgaggccggccccgcgcaccaggagtggtccgacaccgtgcccgtcggcgaggtc
atggacgtctcgcacgcggcgaacgcctccgtgccgcactcgacggtggtgacgctgacg
gtctcgggcggcccggcgcccgcgacggtcacgcagcaggtgggccgcgaccgcgcagac
gcccaggcggcgctggaggacctcggcttcgccgtcgcgttcacggccgacgaggcgtcc
gagacggtccctgcgggccgcgtcatccgccagacgccgacgagcggcacgcaggcgcac
cggctggacacggtgacgctcaccgtctcgtcggggccgccgatcatcgacgtgcccaac
gtcgtgggcatgcgcaccggcgccgcgacggacacgctgacgcgggccgggttcgaggtc
gacaccgtgaagtacctgggcgggatcctcgacaccgtccggttccaggaccccgagggg
acggccccgaagggttcgaccgtcaagatcaccgtgtggtga

DBGET integrated database retrieval system