KEGG   Xylanimicrobium sp. FW10M-9: ET471_16935Help
Entry
ET471_16935       CDS       T05815                                 

Definition
(GenBank) fumarate reductase/succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00020  Citrate cycle (TCA cycle)
xya00190  Oxidative phosphorylation
xya00650  Butanoate metabolism
xya01100  Metabolic pathways
xya01110  Biosynthesis of secondary metabolites
xya01120  Microbial metabolism in diverse environments
xya01130  Biosynthesis of antibiotics
xya01200  Carbon metabolism
Module
xya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xya_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ET471_16935
   00650 Butanoate metabolism
    ET471_16935
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ET471_16935
Enzymes [BR:xya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ET471_16935
    1.3.5.4  fumarate reductase (quinol)
     ET471_16935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 FAD_oxidored HI0933_like GIDA Thi4 DAO FAD_binding_3 Pyr_redox_3 Lycopene_cycl AlaDh_PNT_C Pyr_redox
Motif
Other DBs
NCBI-ProteinID: QAY71505
UniProt: A0A4P6F7M5
LinkDB All DBs
Position
3642085..3644019
Genome map
AA seq 644 aa AA seqDB search
MTETERYEYDVVVIGAGGAGLRAAIAARERGLRVAIVCKSLFGKAHTVMAEGGCAAAMGN
VAAKDSWQVHFRDTMRGGKFLNSWRMAELHAKEAPDRVWELETWGALFDRTPDGRISQRN
FGGHTYPRLAHVGDRTGLELLRTLQQRIVALQQADHAETGDYEARLRVFAECTVTELLTA
EDGAVAGAFGYWRESGRFIVFEAPAVVLATGGIGKSFKVTSNSWEYTGDGHALAMRAGAG
LVDMEFVQFHPTGMVWPPSVKGILVTESVRGDGGVLKNAAGDRFMFGYVPEVFQGLYAES
EDEADRWYADQDANRRTPDLLPRDEVARAINTEVKEGRGSEHGGVFLDIASRMPAEEIRR
RLPSMYHQFKELADVDITAEQMEVGPTCHYVMGGVGVDPDTGQSSVAGLFAAGECAGGMH
GSNRLGGNSLSDLLVFGRRAGLGAADYVASLGQRPAIDEADVDAAATTALAPFDPPASGE
AGENPYTLHAELQQMMNDLVGIIRTEAEMTQALARLAELRARLRHVVVEGHRQYNPGWHL
ALDLRNMLMVSEAVATSALTRTESRGGHTRDDHPALDPEWRHRVLVSRCVRDGGDDDAVV
PRVAVEAAEREPMREDLLALFDVEELRKYYTAGELAGLTRGGPA
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgagaccgaacggtacgagtacgacgtcgtcgtcatcggcgcgggcggcgccggg
ctgcgtgccgccatcgcggcgcgcgagcgcgggctgcgggtggcgatcgtgtgcaagtcg
ctgttcggcaaggcgcacaccgtcatggccgagggtgggtgcgcggccgcgatgggcaac
gtcgcggcgaaggactcctggcaggtgcacttccgggacacgatgcgcggcggcaagttc
ctcaacagctggcggatggcggagctgcacgccaaggaggcgcccgaccgcgtctgggag
ctcgagacgtggggcgcgctgttcgaccggacgccggacggccggatcagccagcgcaac
ttcggcgggcacacgtacccgcggctcgcgcacgtgggcgaccggacggggctcgagctg
ctgcggaccctgcagcagcgcatcgtcgcgctccagcaggccgaccacgccgagacgggc
gactacgaggcccgcctgcgcgtgttcgccgagtgcaccgtgaccgagctgctcaccgcc
gaggacggcgccgtcgcgggcgcgttcgggtactggcgggagtcgggccggttcatcgtg
ttcgaggcccccgccgtcgtgctggcgacgggcggcatcggcaagtcgttcaaggtgacg
tcgaactcgtgggagtacacgggcgacggccacgcgctcgcgatgcgggccggggccggg
ctcgtcgacatggagttcgtgcagttccacccgacgggcatggtctggccgccgagcgtc
aagggcatcctcgtgaccgagagcgtgcgcggcgacggcggcgtgctcaagaacgccgcc
ggcgaccggttcatgttcgggtacgtcccggaggtgttccagggcctctacgcggagtcg
gaggacgaggcggaccgctggtacgccgaccaggacgccaaccgccgcacccccgacctg
ctgccgcgcgacgaggtggcgcgcgcgatcaacaccgaggtcaaggagggccgcggctcc
gagcacggcggcgtgttcctcgacatcgcgagccgcatgcccgccgaggagatcaggcgc
cgcctgccgtcgatgtaccaccagttcaaggagctggccgacgtggacatcaccgcggag
cagatggaggtcggcccgacgtgccactacgtcatgggcggcgtcggcgtcgacccggac
accgggcagtcgagcgtggccgggctgttcgcggccggcgagtgcgcgggcgggatgcac
gggtccaaccggctgggcggcaactcgctgtccgacctgctggtgttcgggcgccgcgcc
ggcctcggggccgccgactacgtcgccagcctcgggcagcggcccgcgatcgacgaggcc
gacgtcgacgccgccgcgacgacggccctggcgcccttcgaccccccggcgtcgggcgag
gcgggcgagaacccgtacacgctgcacgccgagctgcagcagatgatgaacgacctcgtc
ggcatcatccgcaccgaggccgagatgacgcaggcgctcgcacgcctcgcggagctgcgc
gcccggctgcggcacgtcgtcgtcgaggggcaccggcagtacaacccgggctggcacctc
gcgctcgacctgcgcaacatgctcatggtctccgaggccgtggcgacgtcggcgctcacc
cgcaccgagagccgcggcggccacacgcgcgacgaccacccggcgctcgatccggagtgg
cgccaccgggtgctcgtgtcccgctgcgtgcgcgacggcggcgacgacgacgccgtcgtg
ccgcgggtcgccgtcgaggccgccgagcgggagccgatgcgcgaggacctgctcgcgctg
ttcgacgtcgaggagctcaggaagtactacacggcgggcgagctggccggcctcacgcgg
ggaggcccggcatga

DBGET integrated database retrieval system