KEGG   Xylanimicrobium sp. FW10M-9: ET471_16940Help
Entry
ET471_16940       CDS       T05815                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
xya  Xylanimicrobium sp. FW10M-9
Pathway
xya00020  Citrate cycle (TCA cycle)
xya00190  Oxidative phosphorylation
xya00650  Butanoate metabolism
xya01100  Metabolic pathways
xya01110  Biosynthesis of secondary metabolites
xya01120  Microbial metabolism in diverse environments
xya01130  Biosynthesis of antibiotics
xya01200  Carbon metabolism
Module
xya_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xya_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xya_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:xya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ET471_16940
   00650 Butanoate metabolism
    ET471_16940
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ET471_16940
Enzymes [BR:xya01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ET471_16940
    1.3.5.4  fumarate reductase (quinol)
     ET471_16940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer2 Fer4_7 Fer4_10 Fer4_18 Fer4_16
Motif
Other DBs
NCBI-ProteinID: QAY71506
LinkDB All DBs
Position
3644016..3644768
Genome map
AA seq 250 aa AA seqDB search
MSYDARLRVWRGDADGGALQDYRVEVHDGEVVLDVVHRLQATQAPDLAVRWNCKAGKCGS
CSAEVNGRPRLLCMTQMAGFEPDEPVTITPLRTFPVIRDLVTDVSFNYAKAREIPSFAPP
PDLAPGEYRMAQVDVERSQEFRKCIECFLCQDVCHVLRDHEENKAAYAGPRFLMRVAELE
MHPLDVADRVDAVQDEHGLGRCNITKCCTEVCPEGIRITDNALIPMKERVADRRYDPLVW
LGRTISRRRD
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgacgcccggctccgggtgtggcgcggcgacgccgacggcggcgcgctccag
gactaccgggtcgaggtgcacgacggcgaggtggtgctcgacgtcgtccaccggctccag
gccacgcaggcgccggacctcgcggtgcggtggaactgcaaggcgggcaagtgcgggtcg
tgctcggcggaggtcaacggccggccgcggctcctgtgcatgacgcagatggccggcttc
gagcccgacgagcccgtcacgatcacgcccctgcggacctttcccgtgatccgcgacctg
gtcacggacgtgtcgttcaactacgccaaggcacgcgagatcccgtcgttcgcgccgccg
cccgatctcgcgcccggcgagtaccgcatggcgcaggtcgacgtcgagcggtcgcaggag
ttccgcaagtgcatcgagtgcttcctgtgccaggacgtctgccacgtcctgcgggaccac
gaggagaacaaggccgcctacgccggcccgcgcttcctcatgcgcgtcgcggagctcgag
atgcacccgctcgacgtcgccgaccgcgtcgacgccgtccaggacgagcacgggctgggg
cgctgcaacatcacgaagtgctgcaccgaggtgtgccccgagggcatcaggatcacggac
aacgcgctcatcccgatgaaggagcgcgtcgcggaccgcaggtacgacccgctggtctgg
ctgggccggacgatctcgcgccgccgggactga

DBGET integrated database retrieval system