KEGG   Yersinia aleksiciae: ACZ76_07170Help
Entry
ACZ76_07170       CDS       T03994                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yak  Yersinia aleksiciae
Pathway
yak00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACZ76_07170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yak02000]
    ACZ76_07170
Enzymes [BR:yak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ACZ76_07170
Transporters [BR:yak02000]
 Other Transporters
  Pores ion channels [TC:1]
   ACZ76_07170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AKP33337
LinkDB All DBs
Position
complement(1553858..1554526)
Genome map
AA seq 222 aa AA seqDB search
MVIVHHLNNSRSQRILWMLEELQVPYELKRYQRDPGSLLAPPELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQEAYDAQGLFKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRLGG
PPVPWIIRPVAKALGDGVQKNYLNKQIATHRDYLEQHLTQHQWFAGSDFSAADIQMSFPI
EAINSRGGLQGFPKLQDFLVRIHQRPAYKQAIEKGGAYKLES
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcacgttcacagcgtatcttgtggatgctggaa
gagttgcaagtcccctatgagttgaagcgctatcagcgcgatccgggcagcttgctggca
ccccctgaactgaagaaaatccatccgctaggtaaatcaccggtgatcaccgacggcgat
ctgacgctggcggagtcgggggctatcattgaatatttgcaggaagcctatgacgcgcag
gggctgtttaagccgactggccattatgatcgccagcagtttcgctactggatgcactat
gcggaaggttcattgatgccgctgctagtgatgaagcttatcttcagccgactgggtggg
ccgccagtgccgtggattatccgtccagtcgctaaagcgttaggcgatggggtgcagaaa
aattatctgaataagcaaattgccacccaccgcgattatctggagcagcatctcactcag
catcagtggtttgcgggcagcgatttcagcgcggcagatatccaaatgagcttccctatt
gaggccatcaacagccgtggtggtcttcagggctttccgaaactgcaagatttcttagtg
cggattcatcagcgccccgcttataaacaggcgattgagaagggcggggcctacaaactg
gaaagctga

DBGET integrated database retrieval system