KEGG   Yersinia aleksiciae: ACZ76_09755Help
Entry
ACZ76_09755       CDS       T03994                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
yak  Yersinia aleksiciae
Pathway
yak00220  Arginine biosynthesis
yak01100  Metabolic pathways
yak01110  Biosynthesis of secondary metabolites
yak01130  Biosynthesis of antibiotics
yak01210  2-Oxocarboxylic acid metabolism
yak01230  Biosynthesis of amino acids
Module
yak_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:yak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    ACZ76_09755
Enzymes [BR:yak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     ACZ76_09755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AKP33810
LinkDB All DBs
Position
complement(2162800..2163948)
Genome map
AA seq 382 aa AA seqDB search
MKLPPFIELYRALIATPSISATDSALDQSNEALINLLAGWFADLGFRIEIQPVPDTRHKF
NLLASIGEGNGGLLLAGHTDTVPYDEGRWTRDPFTLTEHDNKLYGLGTADMKGFFAFILD
AVRDIDASQLSKPLYILATADEETTMAGARYFAASSQLRPDFAIIGEPTSLQPVRAHKGH
ISSAIRITGQSGHSSDPARGVNAIDLMHESITELMKLRTTLQERYHNPAFTIPYPTMNFG
HINGGDAANRICACCELHMDIRPLPGLTLSDLDELMTEALAPVSQRWPGRLSIDELHPPI
PGYECPTDHHMVGVIEKLLGERTAVVNYCTEAPFIQQVCPTLVLGPGSINQAHQPDEFID
MAFIEPTRELIGQLVDHFCQQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacctccatttattgagctgtatcgggcgttaatcgccacgccatcgatcagc
gcgaccgatagcgccctcgatcaaagcaatgaggcgttaatcaacttgttggccggatgg
tttgctgatttgggttttcgtatcgaaatccaaccagtacccgatacacgccacaaattt
aacctgcttgccagcattggcgaaggcaatggcggattactgctggccgggcataccgat
actgtgccttatgatgaggggcgttggacccgtgatcccttcacgctgacagagcacgat
aacaagttatatggtttaggcaccgccgatatgaaaggcttttttgcctttattctggat
gcggtacgcgatatcgatgccagccagctgagtaagccgctgtatattctggcaaccgct
gatgaagagaccaccatggcaggcgcgcgctactttgccgcctccagccagttacgccct
gactttgccattattggcgaacctacctcactgcaaccggtgcgggcgcacaaagggcat
atttccagcgcgatccgcattaccggccagtctggccattccagtgatccggcgcgtggc
gtcaatgccattgatttgatgcatgaatccattaccgagctcatgaagctgcgcaccaca
ctgcaagagcgttaccacaatccagcgttcaccatcccttatccgacgatgaatttcggt
catatcaacggcggtgatgctgcaaaccgtatttgtgcttgctgtgaattacatatggat
atccgcccgttaccgggtctgacattaagtgatctggatgaattgatgaccgaagcgctc
gcgccagtcagccaacgctggccgggtcgcttgagcattgatgagctgcatccgccgatt
cctggctatgaatgcccgacagatcaccatatggtgggggttatcgaaaaattattgggt
gagcgcacggcggtggtgaactactgcaccgaagcgccatttattcagcaagtttgccca
acattggtgttggggccaggctcgatcaatcaggcccatcaaccggatgaatttattgat
atggcgtttattgagccaactcgcgagctgattggtcagttagttgaccatttctgccag
cagaaataa

DBGET integrated database retrieval system