KEGG   Yersinia aleksiciae: ACZ76_16100Help
Entry
ACZ76_16100       CDS       T03994                                 

Definition
(GenBank) bifunctional PTS system fructose-specific transporter subunit IIA/HPr protein
  KO
K02768  PTS system, fructose-specific IIA component [EC:2.7.1.202]
K11183  phosphocarrier protein FPr
Organism
yak  Yersinia aleksiciae
Pathway
yak00051  Fructose and mannose metabolism
yak01100  Metabolic pathways
yak01120  Microbial metabolism in diverse environments
yak02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:yak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ACZ76_16100
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ACZ76_16100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yak02000]
    ACZ76_16100
Enzymes [BR:yak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.202  protein-Npi-phosphohistidine---D-fructose phosphotransferase
     ACZ76_16100
Transporters [BR:yak02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Phosphocarrier protein HPr [TC:8.A.8 4.A.2]
    ACZ76_16100
  Enzyme II [TC:4.A]
   Fructose-specific II component
    ACZ76_16100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2 PTS-HPr
Motif
Other DBs
NCBI-ProteinID: AKP34933
LinkDB All DBs
Position
3585705..3586838
Genome map
AA seq 377 aa AA seqDB search
MFQLSTKDIHLAAQADSKKEAITQVAAALTQAGCVAAAYVDGMLAREQQTSTYLGNGIAI
PHGTTDTRDLVLNTGVQVFQFPQGIAWGEDQTAYIVIGIAARSDEHLALLRQLTHVLSDD
AVAAQLAKTTSAEELRSLLMGEKKAAEFHFDTSLIALDVAADNLITLQALNAGRLQQIGA
VDARFVSDVITREPLNLGQGIWLSDSTEGNLVSAATVSRPATAFEHHGEKVALLLTLSVA
DDQPLSVLNYLSDLLLAKKADLLLNADAAALLALLTSEYIEQSEVLSAEFVIRNEHGLHA
RPGTILVNTIKQFTSEITVTNLDGTGKPANGRSLMKVVALGVKKGNRLRFTASGEDAQAA
LDAIGEAIAAGLGEGAA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgttccagttatcgacgaaagatatccatttggctgcacaagcagacagcaaaaaagag
gctatcactcaggtggcagctgcgctgactcaagccggctgcgttgctgccgcttatgtt
gatggcatgctggcccgcgagcagcaaacatctacctatctcggcaatggcatcgccatc
ccacatggtaccactgatacccgcgacttagtgctgaacaccggcgtacaggtgtttcaa
ttcccgcagggcatcgcgtggggcgaagatcaaaccgcctatatcgttatcggcattgcc
gcccgttctgatgagcacttggccttactgcgccagttaacgcacgtattaagtgatgat
gcagtggctgcgcaactggcaaaaaccacctcggctgaagagttacgcagcttgctgatg
ggcgagaaaaaagccgctgaattccatttcgacacctcactgatcgcccttgatgtggcg
gcggacaacctgatcacgctgcaagcgctgaacgcaggtcgtttacagcaaatcggcgca
gttgatgcccgctttgtgagtgatgtgattacccgcgaaccactgaatttggggcagggt
atctggctgagcgacagcaccgagggcaatttggtcagcgccgccacggtgagtcgtcca
gcgacggcctttgagcaccatggcgaaaaagtggctctgctgctgactctctctgtggct
gatgaccaaccgctgtcggtgctgaactatctcagtgacctgctgctggcgaaaaaagct
gatctcttgctgaacgccgatgccgccgcactgctggcactgctgaccagtgagtatatt
gagcaaagcgaagtattaagcgctgaatttgttattcgtaacgaacacggattacatgcg
cgaccagggacgattttagtcaatacaatcaaacagtttaccagtgaaatcaccgtgacc
aacttggacggcaccggtaaacccgctaatggacgtagtctgatgaaagttgtggcttta
ggggttaaaaaaggtaatcgcctacgctttaccgccagcggtgaagatgcacaggcagca
ctggatgctattggtgaagctatcgccgccggtttgggcgagggggcagcatga

DBGET integrated database retrieval system