KEGG   Yersinia aleksiciae: ACZ76_17450Help
Entry
ACZ76_17450       CDS       T03994                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
yak  Yersinia aleksiciae
Pathway
yak00020  Citrate cycle (TCA cycle)
yak00480  Glutathione metabolism
yak01100  Metabolic pathways
yak01110  Biosynthesis of secondary metabolites
yak01120  Microbial metabolism in diverse environments
yak01130  Biosynthesis of antibiotics
yak01200  Carbon metabolism
yak01210  2-Oxocarboxylic acid metabolism
yak01230  Biosynthesis of amino acids
Module
yak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
yak_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:yak00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACZ76_17450
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ACZ76_17450
Enzymes [BR:yak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ACZ76_17450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh tRNA_synt_1c_R1
Motif
Other DBs
NCBI-ProteinID: AKP35178
LinkDB All DBs
Position
3894243..3895496
Genome map
AA seq 417 aa AA seqDB search
MESKVVVPAEGKKITVDAQGKLVVPHNPIIPFIEGDGIGVDVTPAMINVVDAAVKKAYKG
ERKIAWMEIYTGEKSTHVYGKDVWLPEETLDLIRDYRVAIKGPLTTPVGGGIRSLNVALR
QQLDLYVCLRPVRYYEGTPSPVKHPELTNMVIFRENAEDIYAGIEWKAGSPEAEKVIKFL
REEMGVKKIRFPEQCGIGVKPCSEEGTKRLVRAAIEYAITNDRESVTLVHKGNIMKFTEG
AFKDWGYQLAREEFGGELIDGGPWVKIKNPNNGKEIIVKDVIADAFLQQILLRPAEYDVI
ACMNLNGDYISDALAAQVGGIGIAPGANIGDECALFEATHGTAPKYAGQDKVNPGSIILS
AEMMLRHMGWFEAADLIIKGTEGAIQAKTVTYDFERLMDGAKLLKCSEFGDAIIQHM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcaaagtagtggttccggcagaaggtaagaaaattactgtcgatgctcagggt
aaactggttgttccgcataatccgatcattccctttattgaaggtgacggcattggcgtt
gatgtgactccagccatgatcaacgtggtcgatgctgcagtgaagaaagcctataaaggt
gagcgtaaaatcgcctggatggagatctacaccggtgaaaaatcaacgcatgtttatggt
aaagacgtttggttgccagaagaaacgttggatctgattcgtgactatcgcgttgcaatt
aaaggcccattgacgacaccagtcggtggcggtattcgctctttaaacgttgctttacgt
caacaactcgatctgtatgtgtgcctgcgccccgtgcgttattacgaagggacaccaagc
ccggtaaaacaccctgaattaaccaacatggtgattttccgcgaaaacgcagaagacatc
tatgcgggtatcgaatggaaagctggctcaccagaagctgagaaagtcatcaagttccta
cgtgaagagatgggtgtgaagaaaatccgcttccctgaacaatgtggtatcggtgtaaaa
ccttgttcagaagaggggaccaaacgcttggtacgtgctgcgattgagtatgcaattacc
aacgatcgtgaatcagtcactctggttcacaaaggcaacattatgaaattcaccgaaggc
gcatttaaagactggggttaccagttagcgcgtgaggagtttggtggtgaactgatcgac
ggcggcccatgggttaaaatcaagaacccaaacaacggcaaagagatcatcgtgaaagat
gtgattgctgatgccttcctgcaacaaatcctactgcgtcctgctgaatatgatgttatc
gcctgtatgaacctgaacggcgattatatctctgatgcattggctgcacaggttggcggt
atcggtattgcgccaggggccaacattggtgatgaatgtgccttattcgaagccacacac
ggtacggcaccaaaatatgcgggtcaggataaggtgaacccaggttctattattctgtct
gcagaaatgatgttgcgtcatatgggctggttcgaagcggctgatttaattatcaaaggc
accgaaggcgcgattcaggccaagaccgtgacttacgatttcgaacgtctgatggacggc
gctaagctgttgaaatgcagtgaatttggcgacgccattattcagcatatgtaa

DBGET integrated database retrieval system