KEGG   Yersinia aldovae: AT01_1213Help
Entry
AT01_1213         CDS       T03605                                 

Gene name
accD
Definition
(GenBank) acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
yal  Yersinia aldovae
Pathway
yal00061  Fatty acid biosynthesis
yal00620  Pyruvate metabolism
yal00640  Propanoate metabolism
yal01100  Metabolic pathways
yal01110  Biosynthesis of secondary metabolites
yal01120  Microbial metabolism in diverse environments
yal01130  Biosynthesis of antibiotics
yal01200  Carbon metabolism
yal01212  Fatty acid metabolism
Module
yal_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AT01_1213 (accD)
   00640 Propanoate metabolism
    AT01_1213 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AT01_1213 (accD)
Enzymes [BR:yal01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     AT01_1213 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     AT01_1213 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC DZR Tmemb_55A OrfB_Zn_ribbon zf-FPG_IleRS Zn-ribbon_8
Motif
Other DBs
NCBI-ProteinID: AJJ61758
LinkDB All DBs
Position
complement(1303985..1304896)
Genome map
AA seq 303 aa AA seqDB search
MSWIERILNKSNITQTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTAR
ARLHMLLDEGSEVELGSELEPKDLLKFKDSKKYKDRLAAAQKETGEKDALVAMKGTLERM
PIVAVSFEFAFMGGSMASVVGARFVRAVEQALEDNCPLVCFSSSGGARMQEALMSLMQMA
KTSAALAKMQERGLPYISVLTDPTMGGVSASLAMLGDINIAEPKALIGFAGPRVIEQTVR
EKLPPGFQRSEFLIEKGAIDMIVRRPVMRQTLASILSKLTHQSQPSAAEVKADAVTTDNQ
ADA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaacgaattcttaacaaaagcaacatcacgcaaacccgtaaagcgagt
attcctgaaggggtgtggacaaaatgtgatagctgtggccaggtactttatcgtgccgag
ctggagcgtaatctggaagtttgtcctaagtgtgatcatcatatgcgaatgacagcccga
gcacggctacatatgctattggatgaaggcagtgaagttgaattgggtagcgaactggag
ccgaaggatctcctgaaattcaaggattccaaaaagtataaagatcgcctcgctgctgca
caaaaagagacgggcgagaaagatgctctggtcgcgatgaaagggactttagagaggatg
cctatcgttgccgtctcatttgaatttgcctttatgggcggttcaatggcatctgttgtg
ggcgctcgctttgttcgcgcagttgaacaggcactggaggataattgtccgttggtctgt
ttctcttccagtggcggcgcacgtatgcaagaagcactgatgtcattgatgcaaatggca
aaaaccagtgcagcactggctaaaatgcaagagcgcggtttaccctatatttccgtgctg
accgatcctactatgggtggcgtttctgccagtctggcaatgttgggtgatatcaatatt
gcggagccaaaggcgctgatcggttttgcaggccctcgggttattgagcagaccgtacgc
gagaaactaccgccgggcttccagcgcagtgagtttttgattgagaaaggtgcgatcgac
atgatcgttcgtcgtccggtgatgcgccagacactggcgagcatcttgtctaaattgact
catcagtcgcagccaagcgcggctgaagtcaaagccgatgctgttacgacagacaatcaa
gctgatgcctga

DBGET integrated database retrieval system