KEGG   Yersinia aldovae: AT01_1238Help
Entry
AT01_1238         CDS       T03605                                 

Gene name
fadJ
Definition
(GenBank) fatty oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
yal  Yersinia aldovae
Pathway
yal00071  Fatty acid degradation
yal00280  Valine, leucine and isoleucine degradation
yal00281  Geraniol degradation
yal00310  Lysine degradation
yal00362  Benzoate degradation
yal00380  Tryptophan metabolism
yal00410  beta-Alanine metabolism
yal00640  Propanoate metabolism
yal00650  Butanoate metabolism
yal00903  Limonene and pinene degradation
yal00930  Caprolactam degradation
yal01100  Metabolic pathways
yal01110  Biosynthesis of secondary metabolites
yal01120  Microbial metabolism in diverse environments
yal01130  Biosynthesis of antibiotics
yal01200  Carbon metabolism
yal01212  Fatty acid metabolism
Module
yal_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AT01_1238 (fadJ)
   00650 Butanoate metabolism
    AT01_1238 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AT01_1238 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AT01_1238 (fadJ)
   00310 Lysine degradation
    AT01_1238 (fadJ)
   00380 Tryptophan metabolism
    AT01_1238 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AT01_1238 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AT01_1238 (fadJ)
   00281 Geraniol degradation
    AT01_1238 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AT01_1238 (fadJ)
   00930 Caprolactam degradation
    AT01_1238 (fadJ)
Enzymes [BR:yal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AT01_1238 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AT01_1238 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AT01_1238 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AJJ64312
LinkDB All DBs
Position
complement(1331205..1333439)
Genome map
AA seq 744 aa AA seqDB search
MSQEDIIHNSDDVLMPKAIAPATSVFTLSVRPDNIGIITIDVVGEKVNTLKAEFAEQITE
ILQQAQALSGLQGLVIISGKPDSFVAGADIAMIAACHTAQDARVLAQKGQATLAQIAAFP
VPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLLPGSGGTQRLPRLIGV
SKALDMILTGRQVRARQALKMGLVDDIVPLDILLDVAIARAKAGWLDRPTLPWQERLLSG
PLGKAILFNVVRKKTRAKTKGHYPATEYIIDVIRKGLDHGGPSGYEAEARAFGDLAMSPQ
SAALRSLFFATTSLKKETGGAAQPRVIHRVGVLGGGLMGGGIANVTATRAGLPVRIKDIN
PQGINLALKYTWDALGKRVRSKRMRPAERQRQMMLISGTTDYCGFDNVDIVVEAVFEDLA
LKQQMVADIERVGAPHTIFASNTSSLPISQIAAQAQRPEQVIGLHYFSPVDKMPLVEVIP
HEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEAARCLLDGEPIDSIDK
ALVDFGFPVGPLTLLDEVGIDVGTKIMPILVEQLGPRFAAPPSFEVILKDGRKGRKNGRG
FYLYPKAVYPTTQTKGFTWKRRPPKQVDVSVYTLLGITPKAHLEATVIAQRCTMMMLNEA
VRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYLDSLGAEKVVKTLQLLTQQYGERFE
PCQRLVTMAQQQQLFYPQETAPAE
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgagccaggaagatattatccataacagtgatgatgtgcttatgccaaaggcgatagcg
ccagcgacgtcagtatttaccctcagtgtgcggccagacaatattggtattatcaccatt
gatgttgtgggcgaaaaggtaaataccttaaaggctgaatttgctgaacaaatcaccgag
atattgcaacaagcgcaggctttatccggattgcaggggctggtaattatatccggcaaa
ccagactcatttgttgctggtgcggatatcgccatgatcgccgcttgccatacggcacag
gatgctcgggtattggcacaaaaagggcaagcaacgctggcacaaatcgcggcctttccg
gtgccggtggttgctgctatccacggtgcttgtttgggcggggggctggaattggctctg
gcttgtcatagccgaatttgttctctggatgataaaacggtgcttggattgccggaagtg
cagcttggcttacttcccggttcggggggaacgcaacgtttgccacgtttgattggcgtc
agcaaggcgctggatatgatactgaccggcaggcaggttcgcgcgcgtcaggcacttaaa
atggggctggtggatgatatcgtgccactggatatcttattggatgtcgctatcgcacgc
gccaaggctggctggcttgaccgcccaacactgccgtggcaagagcgtttgctcagtggc
ccgctgggtaaggcaatattatttaacgtggtgcgtaagaagacacgggcgaagaccaaa
ggtcattatcctgcaactgaatacattattgatgtgatacgcaaaggcctggatcatggc
ggcccgagcggttatgaagctgaggccagagcatttggtgatttggcgatgtcccctcaa
tctgccgcattgcgcagtttgttctttgccaccacctcgctgaaaaaagagacggggggg
gcggcacaacctcgtgttatccatcgtgttggcgtcttaggcggcggtctgatgggtggc
ggtattgccaatgtaaccgctacccgtgcgggtttgccggtgcgaattaaagatatcaac
ccacaggggatcaatctggcgttgaaatatacctgggatgcgctgggtaaacgggtgcgc
agtaagagaatgcgcccggcagagcggcagcgccagatgatgctgatttccggtactacc
gattattgtggttttgataatgtggatattgttgttgaagcggtatttgaagatttagca
ttgaagcagcaaatggttgccgatatcgagcgtgtcggtgcaccacacactatttttgcc
tccaatacgtcctcgttacccatcagccagatagccgcacaagcgcagcggccagagcag
gtcattggtctgcactactttagcccggtagataagatgccactggtagaggttattcct
catgagaaaaccagtgaagaaactattgctactacagtcgctttggctcgaaaacagggt
aaaacagccattgtggtagctgatcgtgccgggttctatgtaaaccgtattttggctcct
tatatcaatgaagccgcgcgctgtttgctagacggcgagcctatcgattccatcgataaa
gcgttggtggactttggtttcccggttggcccgcttacgctgcttgatgaagtgggaatt
gatgtcgggaccaaaattatgcctatcttggttgagcaattagggccacgttttgcagct
ccgccctcttttgaggtgatcttgaaggatgggcgcaaagggcggaaaaatggccgtggt
ttttatttatatccaaaagcggtatatccaactacgcaaaccaaaggctttacgtggaag
agacgcccgccaaaacaggtggatgtaagtgtttacactcttctgggcatcaccccgaag
gctcatctcgaagccacggtgattgcacagcgttgtaccatgatgatgttgaacgaagct
gtgcgctgtctggatgagtctattattcgtaacccgcgagatggggatatcggcgcggtg
ttcggtattggcttcccgccgttcctcggcggccctttccgttatctggatagcctgggg
gcggagaaggtggtaaaaacgcttcagttattgacgcagcagtatggcgagcgttttgag
ccttgccagcggttggtgacaatggcgcagcagcagcagctattttatccacaggaaacg
gcaccagcagaatag

DBGET integrated database retrieval system