KEGG   Yersinia aldovae: AT01_2117Help
Entry
AT01_2117         CDS       T03605                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yal  Yersinia aldovae
Pathway
yal00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT01_2117
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yal02000]
    AT01_2117
Enzymes [BR:yal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT01_2117
Transporters [BR:yal02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT01_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AJJ61425
LinkDB All DBs
Position
complement(2280863..2281531)
Genome map
AA seq 222 aa AA seqDB search
MVIVHHLNNSRSQRILWMLEELQVPYELKRYQRDPGSLLAPSELKKIHPLGKSPVITDGD
LTLAESGAIIEYLQEAYDAQGLLKPTGHYDRQQFRYWMHYAEGSLMPLLVMKLIFSRLGG
PPVPWIIRPVAKALGDGVQKSYLNKQIATHRDYLEQHLEKNQWFAGSDFSAADIQMSFPI
EAINMRGGFAGFPKLQDFLVRIHQRPAYQQAIEKGGAFKLES
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggtcattgttcaccatctgaataattcacgttcacagcggatcttgtggatgttggaa
gaattgcaagtaccttatgagttgaagcgctatcagcgcgatcctggcagcttgttggca
ccatctgaattgaagaaaatccatccgctgggtaaatcaccggtgattactgacggtgac
ttaacactggcggaatcgggtgccatcattgagtatttgcaggaagcctatgatgcacaa
gggctgcttaaacccaccggccattatgatcgtcagcagttccgttattggatgcattat
gccgaaggttcactgatgccattgctggtgatgaaacttattttcagccgcctgggtggg
ccgccagtaccgtggattatccgtccggtcgccaaagcattgggtgatggggtacagaaa
agttacctgaataagcaaattgccactcaccgcgattatctggaacagcatttagaaaag
aatcaatggtttgctggcagcgattttagcgcggcagatattcagatgagttttcctatt
gaggcaataaatatgcgcggcggttttgcggggttcccgaaactgcaagatttcttagtg
cgcatccatcagcgcccagcttaccaacaggcgattgaaaagggcggcgcttttaaatta
gaaagctaa

DBGET integrated database retrieval system