KEGG   Yersinia aldovae: AT01_2666Help
Entry
AT01_2666         CDS       T03605                                 

Definition
(GenBank) FAD dependent oxidoreductase family protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
yal  Yersinia aldovae
Pathway
yal00564  Glycerophospholipid metabolism
yal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AT01_2666
Enzymes [BR:yal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AT01_2666
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_oxidored Lycopene_cycl GIDA HI0933_like
Motif
Other DBs
NCBI-ProteinID: AJJ61892
LinkDB All DBs
Position
complement(2913693..2915207)
Genome map
AA seq 504 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLLLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLRMAPHIAFPMRFRLPHQPHLRPAWMIRTGLFLYDHLGKRTSLPAS
KGLRFGPESVLKPELVRGFEYSDCWVDDARLVVLNAQEVVERGGEVRTRTKVTRAWREQG
LWMVEAIDVNTGKTLTWRAKGLVNATGPWVKQFFDDGLKLKSPYGIRLIKGSHIVVPRVH
NQPQAYILQNEDHRIVFVIPWLDEYSIIGTTDVEYHGDPKEVKIDSQEIDYLLKVYNDHF
KKQLGRDDIVWTYSGVRPLCDDESDSPQAVTRDYTLDVADDAGKAPLLSVFGGKLTTYRK
LAEHALEKLSGYYSNIGPAWTKNGALPGGDIGGSRDNYIVQLRHRHNWLPEGLARRYTCT
YGSHSELILADATRIESLGEHFGHGLYEAELRYLVEKEWVVELDDAIWRRTKLGMMLDDA
QKQRVAQWLAQAQAEKQQALSLVS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagacttgatcgttatcggtggtggtatcaacggtgccggtatcgctgcg
gatgctgcagggcgtggcctgtcagttctgctgctggaagcgcaagacttggcctgtgct
acgtcttccgccagctccaaacttatccacggtggcttgcgctatctggaacattacgaa
ttccgtctggtgagcgaagcactggctgaacgcgaagttttactgagaatggcaccgcac
atcgccttccccatgcgtttccgcttaccccatcagccccatctgcgcccggcgtggatg
attcgcaccggtttgttcctgtacgaccatttaggcaagcgtaccagcctgcctgccagt
aaagggctacgttttgggcctgaatccgtattgaaacctgaattagtgcgcggtttcgaa
tattcggactgctgggtagatgatgctcgtctggtggtgctgaatgctcaggaagtcgtc
gagcgtggcggtgaagtccgtacccgtaccaaagtgacccgtgcctggcgtgagcaaggc
ctgtggatggttgaagccattgacgtcaataccggtaaaaccctcacctggcgcgccaaa
ggcttagtcaatgcgaccggcccgtgggttaaacaattcttcgacgatggtctgaagctg
aaatcaccttatggcatccgcctgattaaaggcagccatattgtggtgccacgcgtgcat
aaccaaccacaggcttatattctgcaaaacgaagaccaccgcatcgttttcgtcatcccg
tggttggatgaatattccatcatcggtacgacagatgtggaatatcacggcgatccgaaa
gaggtgaagatcgactcacaggagatagactatctgctgaaagtgtataacgatcacttt
aaaaagcagttgggccgtgacgatatcgtctggacctattctggtgtgcgcccgctgtgt
gacgatgaatcggattcgccgcaagccgtcacccgtgattacacactggatgtcgccgat
gacgccggtaaagcaccattgctgtcagtattcggtggcaaattgaccacgtatcgcaag
ttggctgaacacgcactggaaaaactgtccggttactattccaatatcggcccagcgtgg
accaaaaacggcgcgctgccaggtggtgatattggtggcagccgcgataactatattgtt
caactgcgccaccgccacaactggttacccgaagggctggcccgtcgctatacctgcact
tacggtagccatagcgaactgatactggcggatgccacccgtatcgagagcttaggtgaa
cacttcggccacggtctgtatgaggcagaactgcgttatctggttgagaaagagtgggta
gttgaactggatgatgctatctggcgtcgtaccaagttaggcatgatgctggacgatgcg
cagaaacagcgcgttgcacaatggctggcgcaagcacaagcagagaaacagcaggcactg
tcgctggtttcctga

DBGET integrated database retrieval system