KEGG   Yersinia aldovae: AT01_319Help
Entry
AT01_319          CDS       T03605                                 

Gene name
gstB
Definition
(GenBank) glutathione S-transferase GST-6.0
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
yal  Yersinia aldovae
Pathway
yal00480  Glutathione metabolism
yal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT01_319 (gstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:yal02000]
    AT01_319 (gstB)
Enzymes [BR:yal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT01_319 (gstB)
Transporters [BR:yal02000]
 Other transporters
  Pores ion channels [TC:1]
   AT01_319 (gstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_N_2 GST_C_3 GST_C_2 Glutaredoxin2_C GST_C_6 Jiv90
Motif
Other DBs
NCBI-ProteinID: AJJ63258
LinkDB All DBs
Position
complement(321690..322295)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPNACSLSPHIILREAGLDFSIESVDLASKITETGKNYLSINPKGQVPALVLDDG
SLLTEGVAIVQYLADIVPDRHLIAPSGTLARYHAIEWLNFVATELHKGFSPLFNPKTPEE
YKIIARERLNNQFSYVDSVLAQHDYLLGKKFSVADAYLFTVTRWATALNVEITARSHLDQ
YMVRVAERTAVKAALAAEKIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataaacccaatgcctgttctctgtctccccatattatattacgtgaa
gcagggttagacttcagtattgaaagcgttgacctggccagtaaaattactgaaacgggt
aaaaactatttgagcatcaaccctaaagggcaagttcccgcgttggtactcgatgacggc
agtttactgaccgaaggtgttgctatcgtgcaatatctggcagatattgtgccagatcgc
cacttgatcgcaccatcgggcacccttgctcgctaccatgccattgaatggttaaacttc
gttgccactgaattacacaaaggcttcagcccgctgtttaacccgaaaacacctgaagaa
tataaaatcattgcgcgtgaacgcctgaataatcaattcagctatgttgacagtgtatta
gcacagcatgattatctgttgggcaaaaaattcagtgtggctgatgcttatttatttacc
gtaactcgttgggccacagcccttaatgttgaaataacagctcgcagccatttagatcaa
tatatggtacgtgttgctgaacgcacggcagtaaaagccgcgctagccgcagaaaagata
aaataa

DBGET integrated database retrieval system